Home » ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 » ST8SIA4 Antibodies » ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody

ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody [NBP2-55496] - Staining of human cell line A549 shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody [NBP2-55496] - Staining of human cell line A549 shows localization to the Golgi apparatus. Antibody staining is shown in green.

Product Details

Summary
Product Discontinued
View other related ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-55496
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFMVKGGEKHVEWVNAL
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST8SIA4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody

  • Alpha-2,8-sialyltransferase 8D
  • CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase
  • CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase
  • EC 2.4.99
  • EC 2.4.99.-
  • polysialyltransferase-1
  • PST1
  • PST1MGC61459
  • PSTMGC34450
  • sialyltransferase 8 (alpha-2, 8-polysialytransferase) D
  • Sialyltransferase 8D
  • Sialytransferase St8Sia IV
  • SIAT8D
  • SIAT8-D
  • ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
  • ST8SIA4
  • ST8SIAIV
  • ST8SIA-IV

Background

The protein encoded by the ST8SIA4 gene catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). The encoded protein, which is a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ST8
alpha-2,8-Sialyltrans ...
AF6590
Western Blot ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]
Immunohistochemistry ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
NCAM-1/CD56
Antibody [Unconjugate
AF2408
Western Blot NCAM-1/CD56 Antibody [Unconjugated]
Simple Western NCAM-1/CD56 Antibody [Unconjugated]
Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]
(27 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(18 Publications)
Species: Hu
Applications: ELISA
SMC3 Antibody -
BSA Free
NB100-207
Unknown SMC3 Antibody - BSA Free
Western Blot SMC3 Antibody - BSA Free
Immunohistochemistry-Paraffin SMC3 Antibody - BSA Free
(9 Publications)
Species: Ce, Hu, Mu
Applications: IHC,  IHC-P, IP, WB
Bim Antibody - BSA
Free
NBP1-76963
Western Blot Bim Antibody - BSA Free
Western Blot Bim Antibody - BSA Free
Western Blot Bim Antibody - BSA Free
(8 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
PSAT1 Antibody
NBP1-32920
Immunocytochemistry/ Immunofluorescence PSAT1 Antibody
Immunohistochemistry-Paraffin PSAT1 Antibody
Western Blot PSAT1 Antibody
(13 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
Protein S/PROS1
Antibody [Unconjugate
AF4036
Western Blot Protein S/PROS1 Antibody [Unconjugated]
Simple Western Protein S/PROS1 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: Simple Western, WB
PLAG1 Antibody
(3B7) - Azide and BSA ...
H00005324-M02
Immunohistochemistry PLAG1 Antibody (3B7) - Azide and BSA Free
Immunohistochemistry PLAG1 Antibody (3B7) - Azide and BSA Free
ELISA PLAG1 Antibody (3B7) - Azide and BSA Free
(20 Publications)
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB

Puromycin-sensitive am ...
NBP3-48658
Western Blot Puromycin-sensitive aminopeptidase/NPEPPS Antibody (HL1531)
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody (HL1531)
Immunocytochemistry/ Immunofluorescence Puromycin-sensitive aminopeptidase/NPEPPS Antibody (HL1531)
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
AKAP4 Antibody -
BSA Free
NBP1-89165
Immunohistochemistry-Paraffin AKAP4 Antibody - BSA Free
Immunohistochemistry-Paraffin AKAP4 Antibody - BSA Free
Immunohistochemistry-Paraffin AKAP4 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: IHC,  IHC-P
SUR1 Antibody
(S289-16) - BSA Free
NBP2-59320
Western Blot SUR1 Antibody (S289-16) - BSA Free
Immunocytochemistry/ Immunofluorescence SUR1 Antibody (S289-16) - BSA Free
Western Blot SUR1 Antibody (S289-16) - BSA Free
(2 Reviews)
(4 Publications)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(30 Publications)
Species: Bv, Hu, Mu
Applications: ICC, IHC
Cav1.2 Antibody
(S57) - BSA Free
NBP1-22439
Immunocytochemistry/ Immunofluorescence Cav1.2 Antibody (S57) - BSA Free
Western Blot Cav1.2 Antibody (S57) - BSA Free
Immunohistochemistry Cav1.2 Antibody (S57) - BSA Free
(3 Publications)
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(16 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Thromboxane
synthase Antibody (OT
NBP2-02710
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
(1 Publication)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
Thymidylate
Synthase Antibody (HL ...
NBP3-25721
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Immunohistochemistry-Paraffin Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP2-55496) (0)

There are no publications for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP2-55496).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP2-55496) (0)

There are no reviews for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP2-55496). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP2-55496) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Products

Research Areas for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody (NBP2-55496)

Find related products by research area.

Blogs on ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4

There are no specific blogs for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4, but you can read our latest blog posts.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ST8SIA4