SSX3 Antibody - Azide and BSA Free

Western Blot: SSX3 Antibody [H00010214-B01P] - Analysis of SSX3 expression in transfected 293T cell line by SSX3 polyclonal antibody. Lane 1: SSX3 transfected lysate(20.68 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SSX3 Antibody - Azide and BSA Free Summary

• Immunogen: SSX3 (NP_066294.1, 1 a.a. - 188 a.a.) full-length human protein. MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE
• Specificity: SSX3 - synovial sarcoma, X breakpoint 3,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: SSX3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SSX3 Antibody - Azide and BSA Free

• CT5.3Cancer/testis antigen 5.3
• MGC119054
• MGC14495
• protein SSX3
• synovial sarcoma, X breakpoint 3

Background

The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This gene appears not to be involved in this type of chromosome translocation. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SSX3
• Entrez:
  • 10214(Human)
• Uniprot:
  • NP_066294.1(Human)