ZNF3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ZNF3 Antibody [NBP1-89329] - Staining of human cerebellum shows nuclear positivity in Purkinje cells, as well as in the molecular and granular cell layers.
Immunocytochemistry/ Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse midbrain shows nuclear staining in neurons of the oculomotor and red nuclei.
Immunocytochemistry/ Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse piriform cortex shows nuclear staining in the neurons of layer 2.
Immunocytochemistry/ Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse hypothalamus shows nuclear positivity in the neurons of medial preoptic area.
Immunocytochemistry/ Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse hypothalamus shows nuclear immunoreactivity in the neurons in the arcuate nucleus.
Immunocytochemistry/ Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse visual cortex shows nuclear positivity in neurons.
Immunohistochemistry-Paraffin: ZNF3 Antibody [NBP1-89329] - Staining of human duodenum shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ZNF3 Antibody [NBP1-89329] - Staining of human cerebral cortex shows nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: ZNF3 Antibody [NBP1-89329] - Staining of human cerebral cortex shows strong nuclear immunoreactivity in neurons.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGLKFKEAYEREVSLKRPLGNSPGERLNRK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF3 Protein (NBP1-89329PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF3 Antibody

  • FLJ12827
  • PFM14
  • PR domain zinc finger protein 17
  • PRDM17
  • zinc finger protein 408

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2608
Species: Hu
Applications: WB
NBP1-83705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP1-77350
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF470
Species: Mu
Applications: WB, IHC, Neut
NBP2-31832
Species: Hu
Applications: IHC, IHC-P
NBP1-92353
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00053405-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89329
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for ZNF3 Antibody (NBP1-89329) (0)

There are no publications for ZNF3 Antibody (NBP1-89329).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF3 Antibody (NBP1-89329) (0)

There are no reviews for ZNF3 Antibody (NBP1-89329). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF3 Antibody (NBP1-89329) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF3 Products

Bioinformatics Tool for ZNF3 Antibody (NBP1-89329)

Discover related pathways, diseases and genes to ZNF3 Antibody (NBP1-89329). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF3 Antibody (NBP1-89329)

Discover more about diseases related to ZNF3 Antibody (NBP1-89329).

Blogs on ZNF3

There are no specific blogs for ZNF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF3