SSX7 Antibody

Images

 
Western Blot: SSX7 Antibody [NBP1-79468] - Human Pancrease lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SSX7 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human SSX7The immunogen for this antibody is SSX7. Peptide sequence IFPKIMPKKPAEEGNDSKGVPEASGSQNDGKHLCPPGKPSTSEKINKTSG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SSX7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against SSX7 and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SSX7 Antibody

  • protein SSX7
  • synovial sarcoma, X breakpoint 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80180
Species: Hu
Applications: WB
NBP1-48008
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-79469
Species: Hu
Applications: WB
NBP2-00614
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-79468
Species: Hu
Applications: WB

Publications for SSX7 Antibody (NBP1-79468) (0)

There are no publications for SSX7 Antibody (NBP1-79468).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSX7 Antibody (NBP1-79468) (0)

There are no reviews for SSX7 Antibody (NBP1-79468). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SSX7 Antibody (NBP1-79468) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SSX7 Products

Array NBP1-79468

Bioinformatics Tool for SSX7 Antibody (NBP1-79468)

Discover related pathways, diseases and genes to SSX7 Antibody (NBP1-79468). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSX7 Antibody (NBP1-79468)

Discover more about diseases related to SSX7 Antibody (NBP1-79468).
 

Pathways for SSX7 Antibody (NBP1-79468)

View related products by pathway.

PTMs for SSX7 Antibody (NBP1-79468)

Learn more about PTMs related to SSX7 Antibody (NBP1-79468).

Blogs on SSX7

There are no specific blogs for SSX7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SSX7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SSX7
Uniprot