SSB Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SSB. Source: E. coli
Amino Acid Sequence: AKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SSB |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82851. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SSB Recombinant Protein Antigen
Background
Members of the suppressor of cytokine signaling (SOCS) family of proteins contain C-terminal regions of homology called the SOCS box, which serves to couple SOCS proteins and their binding partners with the Elongin B and C complex, thereby mediating protein degradation. Several other families of proteins also contain SOCS boxes, but differ from the SOCS proteins in the type of domain they contain upstream of the SOCS box. SSB-2 (SplA/ryanodine (SPRY) receptor domain-containing SOCS box protein 2), also known as GGRCC9 (gene-rich cluster protein C9), SPSB2 or MGC2519, is a cytoplasmic protein belonging to the SPSB family of proteins that contain a central SPRY domain and a C-terminal SOCS box. The SPRY domain is believed to be a protein-protein interaction motif. Members of the SPSB family are capable of interacting with Met (a receptor for hepatocyte growth factors (HGFs)), and SSB-1 is known to promote HGF signaling. SSB-1, SSB-2 and SSB-4 are also able to interact with PAR4 (prostate apoptosis response protein 4). Mutations in the genes encoding SPSB proteins are associated with several human diseases.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: Block, ICC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: AC
Publications for SSB Protein (NBP1-82851PEP) (0)
There are no publications for SSB Protein (NBP1-82851PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SSB Protein (NBP1-82851PEP) (0)
There are no reviews for SSB Protein (NBP1-82851PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SSB Protein (NBP1-82851PEP) (0)
Additional SSB Products
Research Areas for SSB Protein (NBP1-82851PEP)
Find related products by research area.
|
Blogs on SSB