SRY Antibody

Images

 
Western Blot: SRY Antibody [H00006736-B01P] - Analysis of SRY expression in transfected 293T cell line by SRY polyclonal antibody. Lane 1: SRY transfected lysate(22.44 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: SRY Antibody [H00006736-B01P] - Analysis of purified antibody to SRY on Hs 181.Tes cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SRY Antibody Summary

Immunogen
SRY (NP_003131.1, 1 a.a. - 204 a.a.) full-length human protein. MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL
Specificity
SRY - sex determining region Y,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SRY
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB, ELISA and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SRY Antibody

  • essential protein for sex determination in human males
  • sex determining region Y
  • sex-determining region on Y
  • sex-determining region Y protein
  • TDFsex determining region protein
  • TDY
  • Testis-determining factor

Background

This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3075
Species: Hu
Applications: WB, ICC
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-80583
Species: Hu
Applications: IHC, IHC-P
PP-H7431-00
Species: Hu
Applications: WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP2-41198
Species: Hu, Mu
Applications: WB, ELISA
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF475
Species: Mu
Applications: WB, IHC
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
22240002
Species: Hu
Applications: WB, ELISA
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2569
Species: Hu
Applications: WB, ICC
NBP1-32887
Species: Hu
Applications: WB, IHC, IHC-P
H00006736-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for SRY Antibody (H00006736-B01P) (0)

There are no publications for SRY Antibody (H00006736-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRY Antibody (H00006736-B01P) (0)

There are no reviews for SRY Antibody (H00006736-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SRY Antibody (H00006736-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRY Products

Bioinformatics Tool for SRY Antibody (H00006736-B01P)

Discover related pathways, diseases and genes to SRY Antibody (H00006736-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRY Antibody (H00006736-B01P)

Discover more about diseases related to SRY Antibody (H00006736-B01P).
 

Pathways for SRY Antibody (H00006736-B01P)

View related products by pathway.

PTMs for SRY Antibody (H00006736-B01P)

Learn more about PTMs related to SRY Antibody (H00006736-B01P).

Blogs on SRY

There are no specific blogs for SRY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRY Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRY
Entrez
Uniprot