SRRM1 Antibody - BSA Free

Western Blot: SRRM1 Antibody [NBP2-57064] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: SRRM1 Antibody [NBP2-57064] - Staining of human cell line HEK 293 shows localization to nuclear speckles.

• Reactivity: Hu
• Applications: WB, ICC/IF, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SRRM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SRRM1 Antibody - BSA Free (NBP2-57064) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IAAATTTLAQEEPVAAPEPKKETESEAEDNLDDLEKHLREKALRSMRKAQVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SRRM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SRRM1 Recombinant Protein Antigen (NBP2-57064PEP)

Reactivity Notes

Mouse 87%, Rat 83%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SRRM1 Antibody - BSA Free

• MGC39488
• POP101
• Ser/Arg-related nuclear matrix protein
• serine/arginine repetitive matrix 1
• serine/arginine repetitive matrix protein 1
• SRm160
• SRM160160-KD
• SR-related nuclear matrix protein of 160 kDa

Background

Part of pre- and post-splicing multiprotein mRNP complexes. Involved in numerous pre-mRNA processing events. Promotes constitutive and exonic splicing enhancer (ESE)-dependent splicing activation by bridging together sequence-specific (SR family proteins, SFRS4, SFRS5 and TRA2B/SFRS10) and basal snRNP (SNRP70 and SNRPA1) factors of the spliceosome. Stimulates mRNA 3'-end cleavage independently of the formation of an exon junction complex. Binds both pre-mRNA and spliced mRNA 20-25 nt upstream of exon-exon junctions. Binds RNA and DNA with low sequence specificity and has similar preference for either double- or single-stranded nucleic acid substrates

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SRRM1