SRPK2 Partial Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

SRPK2 Partial Recombinant Protein Summary

Description
SRPK2 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWLNS
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
SRPK2

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SRPK2 Partial Recombinant Protein

  • EC 2.7.11.1
  • FLJ36101
  • H_RG152G17.1a
  • H_RG152G17.1b
  • serine kinase SRPK2
  • Serine/arginine-rich protein-specific kinase 2
  • serine/arginine-rich splicing factor kinase 2
  • serine/threonine-protein kinase SRPK2
  • SFRS protein kinase 2SFRSK2
  • SFRSK2
  • SR protein kinase 2
  • SRPK2
  • SR-protein-specific kinase 2
  • SRSF protein kinase 2
  • WUGSC:H_RG152G17.1a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006732-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB5745R
Species: Hu
Applications: WB, IHC, ICC
AF6387
Species: Hu
Applications: WB
NBP2-20324
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92343
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
MAB2055
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, ICFlow
NBP1-67948
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-88053
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24695
Species: Hu
Applications: WB, IHC-P
AF800
Species: Hu, Mu
Applications: WB, Simple Western, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-30881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB7046
Species: Hu
Applications: WB, IHC
H00003930-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for SRPK2 Partial Recombinant Protein (H00006733-Q01) (0)

There are no publications for SRPK2 Partial Recombinant Protein (H00006733-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRPK2 Partial Recombinant Protein (H00006733-Q01) (0)

There are no reviews for SRPK2 Partial Recombinant Protein (H00006733-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRPK2 Partial Recombinant Protein (H00006733-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SRPK2 Partial Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for SRPK2 Partial Recombinant Protein (H00006733-Q01)

Discover related pathways, diseases and genes to SRPK2 Partial Recombinant Protein (H00006733-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRPK2 Partial Recombinant Protein (H00006733-Q01)

Discover more about diseases related to SRPK2 Partial Recombinant Protein (H00006733-Q01).
 

Pathways for SRPK2 Partial Recombinant Protein (H00006733-Q01)

View related products by pathway.

PTMs for SRPK2 Partial Recombinant Protein (H00006733-Q01)

Learn more about PTMs related to SRPK2 Partial Recombinant Protein (H00006733-Q01).
 

Research Areas for SRPK2 Partial Recombinant Protein (H00006733-Q01)

Find related products by research area.

Blogs on SRPK2

There are no specific blogs for SRPK2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SRPK2
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00006733-Q01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

SRPK2 Recombinant Protein
H00006733-P02-10ug
SRPK2 Antibody
NBP1-87049
SRPK2 Antibody
NBP1-87049
SRPK2 Antibody
NBP1-87049