Recombinant Human SRPK2 Protein (H00006733-Q01)

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SRPK2 Protein Summary

Description
SRPK2 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWLNS
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SRPK2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SRPK2 Protein

  • EC 2.7.11.1
  • FLJ36101
  • H_RG152G17.1a
  • H_RG152G17.1b
  • serine kinase SRPK2
  • Serine/arginine-rich protein-specific kinase 2
  • serine/arginine-rich splicing factor kinase 2
  • serine/threonine-protein kinase SRPK2
  • SFRS protein kinase 2SFRSK2
  • SFRSK2
  • SR protein kinase 2
  • SRPK2
  • SR-protein-specific kinase 2
  • SRSF protein kinase 2
  • WUGSC:H_RG152G17.1a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006732-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92343
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00001195-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-88053
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-30881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-02902
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready

Publications for SRPK2 Partial Recombinant Protein (H00006733-Q01) (0)

There are no publications for SRPK2 Partial Recombinant Protein (H00006733-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRPK2 Partial Recombinant Protein (H00006733-Q01) (0)

There are no reviews for SRPK2 Partial Recombinant Protein (H00006733-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRPK2 Partial Recombinant Protein (H00006733-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SRPK2 Products

Related Products by Gene

Bioinformatics Tool for SRPK2 Partial Recombinant Protein (H00006733-Q01)

Discover related pathways, diseases and genes to SRPK2 Partial Recombinant Protein (H00006733-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRPK2 Partial Recombinant Protein (H00006733-Q01)

Discover more about diseases related to SRPK2 Partial Recombinant Protein (H00006733-Q01).
 

Pathways for SRPK2 Partial Recombinant Protein (H00006733-Q01)

View related products by pathway.

PTMs for SRPK2 Partial Recombinant Protein (H00006733-Q01)

Learn more about PTMs related to SRPK2 Partial Recombinant Protein (H00006733-Q01).
 

Research Areas for SRPK2 Partial Recombinant Protein (H00006733-Q01)

Find related products by research area.

Blogs on SRPK2

There are no specific blogs for SRPK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SRPK2 Antibody
NBP1-87048
SRPK2 Antibody
NBP1-87048
SRPK2 Antibody
NBP1-87048

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SRPK2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SRPK2
Entrez