Splicing factor, arginine/serine-rich 11 Antibody - BSA Free

Western Blot: Splicing factor, arginine/serine-rich 11 Antibody [NBP1-57324] - Hela cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Splicing factor, arginine/serine-rich 11 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SFRS11(splicing factor, arginine/serine-rich 11) The peptide sequence was selected from the C terminal of SFRS11. Peptide sequence KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIET. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SRSF11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Splicing factor, arginine/serine-rich 11 Antibody - BSA Free

• Arginine-rich 54 kDa nuclear protein
• dJ677H15.2
• DKFZp686M13204
• p54NET2
• serine/arginine-rich splicing factor 11
• SFRS11
• splicing factor p54
• Splicing factor, arginine/serine-rich 11FLJ18226
• SR splicing factor 11

Background

SFRS11 is 54-kD nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may play a role in pre-mRNA processing.This gene encodes 54-kD nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may play a role in pre-mRNA processing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SRSF11
• Uniprot:
  • Q05519(Human)