Recombinant Human SPCS1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SPCS1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-104 of Human SPCS1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLAQLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SPCS1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPCS1 Protein

  • EC 3.4
  • HSPC033
  • Microsomal signal peptidase 12 kDa subunit
  • signal peptidase 12kDa
  • signal peptidase complex subunit 1 homolog (S. cerevisiae)
  • signal peptidase complex subunit 1
  • SPase 12 kDa subunit
  • SPC12SPC1
  • YJR010C-A

Background

SPCS1( AAH00884, 1 a.a. - 105 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-30420
Species: Hu
Applications: IHC, IHC-P
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
H00000466-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
2984-SE
Species: Hu
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for SPCS1 Recombinant Protein (H00028972-P01) (0)

There are no publications for SPCS1 Recombinant Protein (H00028972-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPCS1 Recombinant Protein (H00028972-P01) (0)

There are no reviews for SPCS1 Recombinant Protein (H00028972-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPCS1 Recombinant Protein (H00028972-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPCS1 Products

Bioinformatics Tool for SPCS1 Recombinant Protein (H00028972-P01)

Discover related pathways, diseases and genes to SPCS1 Recombinant Protein (H00028972-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPCS1

There are no specific blogs for SPCS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SPCS1 Antibody
NBP1-92433
GDNF [Unconjugated]
212-GD-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPCS1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPCS1