Recombinant Human SPATA9 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SPATA9 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-254 of Human SPATA9 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISRSSKSVAKLLHPQLACRLLELRDISGRLLREVNAPRQPLYNIQVRKGSLFEIISFPAKTALTSIIYASYAALIYLAVCVNAVLKKVKNIFQEEESIRQNREESENCRKAFSEPVLSEPMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSNNIQVLHSVFDQSAEMNEQI

Protein/Peptide Type
Recombinant Protein
Gene
SPATA9

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPATA9 Protein

  • FLJ35906
  • NYD-SP16
  • spermatogenesis associated 9
  • spermatogenesis-associated protein 9
  • Testis development protein NYD-SP16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45881
Species: Hu
Applications: WB, Flow, IHC, IF
28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-14802
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88730
Species: Hu
Applications: IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4977
Species: Mu
Applications: WB
NBP2-45600
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
NBP1-31566
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB9161
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
302-B2/CF
Species: Hu
NBP1-56363
Species: Hu
Applications: WB
1849-NK
Species: Hu
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NB100-56341
Species: Hu
Applications: WB, ChIP, IP
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
H00083890-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SPATA9 Recombinant Protein (H00083890-P01) (0)

There are no publications for SPATA9 Recombinant Protein (H00083890-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA9 Recombinant Protein (H00083890-P01) (0)

There are no reviews for SPATA9 Recombinant Protein (H00083890-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPATA9 Recombinant Protein (H00083890-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPATA9 Products

Bioinformatics Tool for SPATA9 Recombinant Protein (H00083890-P01)

Discover related pathways, diseases and genes to SPATA9 Recombinant Protein (H00083890-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPATA9 Recombinant Protein (H00083890-P01)

Discover more about diseases related to SPATA9 Recombinant Protein (H00083890-P01).

Blogs on SPATA9

There are no specific blogs for SPATA9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SPATA9 Antibody
NBP1-83493
TGF-beta 2
302-B2-002/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPATA9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPATA9