SPATA12 Antibody - BSA Free

Immunohistochemistry-Paraffin: SPATA12 Antibody [NBP3-17143] -Analysis in human testis and endometrium tissues using Anti-SPATA12 antibody. Corresponding SPATA12 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SPATA12 Antibody [NBP3-17143] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: SPATA12 Antibody [NBP3-17143] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPATA12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPATA12 Antibody - BSA Free (NBP3-17143) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TQHPNKPHCALASCQGPGVLPGAASALPELTFQGDVCQSETCQRYLQAAISLDIA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPATA12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SPATA12 Antibody - BSA Free

• spermatogenesis associated 12
• spermatogenesis-associated protein 12
• SRG5Spermatogenesis-related protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPATA12