Spastin Antibody (3A12)

Images

 
Sandwich ELISA: Spastin Antibody (3A12) [H00006683-M01] - Detection limit for recombinant GST tagged SPAST is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3A12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Spastin Antibody (3A12) Summary

Immunogen
SPAST (NP_055761 200 a.a. - 304 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVLPFSKSQTDVYNDSTNLACRNGHLQSESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTP
Specificity
SPAST - spastin
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPAST
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Spastin Antibody (3A12)

  • ADPSPSpastic paraplegia 4 protein
  • FSP2EC 3.6.4.3
  • KIAA1083EC 3.6.1.3
  • spastic paraplegia 4 (autosomal dominant; spastin)
  • spastin
  • SPG4

Background

This gene encodes a member of the AAA (ATPases associated with a variety of cellular activities) protein family. Members of this protein family share an ATPase domain and have roles in diverse cellular processes including membrane trafficking, intracellular motility, organelle biogenesis, protein folding, and proteolysis. The encoded ATPase may be involved in the assembly or function of nuclear protein complexes. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants have been described but their full length sequences have not been determined. Mutations associated with this gene cause the most frequent form of autosomal dominant spastic paraplegia 4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00051062-M03
Species: Hu, Rt
Applications: WB, ELISA
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP2-59312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-47203
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-85344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93476
Species: Hu
Applications: IHC, IHC-P
NBP1-83512
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-87014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59662
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
NB100-56441
Species: Hu, Mu, Rt
Applications: WB
NBP1-82143
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006683-M01
Species: Hu
Applications: WB, ELISA

Publications for Spastin Antibody (H00006683-M01) (0)

There are no publications for Spastin Antibody (H00006683-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Spastin Antibody (H00006683-M01) (0)

There are no reviews for Spastin Antibody (H00006683-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Spastin Antibody (H00006683-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Spastin Products

Bioinformatics Tool for Spastin Antibody (H00006683-M01)

Discover related pathways, diseases and genes to Spastin Antibody (H00006683-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Spastin Antibody (H00006683-M01)

Discover more about diseases related to Spastin Antibody (H00006683-M01).
 

Pathways for Spastin Antibody (H00006683-M01)

View related products by pathway.

PTMs for Spastin Antibody (H00006683-M01)

Learn more about PTMs related to Spastin Antibody (H00006683-M01).

Blogs on Spastin

There are no specific blogs for Spastin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Spastin Antibody (3A12) and receive a gift card or discount.

Bioinformatics

Gene Symbol SPAST
Entrez
Uniprot