SPAG16 Antibody - BSA Free

Western Blot: SPAG16 Antibody [NBP2-85796] - Host: Rabbit. Target Name: SPAG16. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SPAG16 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPAG16 Antibody - BSA Free (NBP2-85796) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPAG16. Peptide sequence: LENENKNLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPAG16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SPAG16 Antibody - BSA Free

• DKFZp666P1710
• FLJ22724
• FLJ37717
• Pf20 protein homolog
• PF20MGC87036
• sperm associated antigen 16
• sperm-associated antigen 16 protein
• sperm-associated WD repeat protein
• WD repeat domain 29
• WDR29

Background

Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. SPAG16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic germ cells, respectively (Zhang et al., 2007 [PubMed 17699735]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPAG16