SOX22 Antibody (2D3)


Sandwich ELISA: SOX22 Antibody (2D3) [H00006666-M09] - Detection limit for recombinant GST tagged SOX12 is 0.1 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

SOX22 Antibody (2D3) Summary

SOX12 (NP_008874 252 a.a. - 313 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF
SOX12 (2D3)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX22 Antibody (2D3)

  • Protein SOX-22
  • SOX-22 protein
  • SOX22transcription factor SOX-12
  • SRY (sex determining region Y)-box 12
  • SRY (sex determining region Y)-box 22
  • SRY-related HMG-box gene 22


Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, ICC
Species: Hu
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Ch, Fe, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for SOX22 Antibody (H00006666-M09) (0)

There are no publications for SOX22 Antibody (H00006666-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX22 Antibody (H00006666-M09) (0)

There are no reviews for SOX22 Antibody (H00006666-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX22 Antibody (H00006666-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SOX22 Products

Bioinformatics Tool for SOX22 Antibody (H00006666-M09)

Discover related pathways, diseases and genes to SOX22 Antibody (H00006666-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX22 Antibody (H00006666-M09)

Discover more about diseases related to SOX22 Antibody (H00006666-M09).

Pathways for SOX22 Antibody (H00006666-M09)

View related products by pathway.

Blogs on SOX22

There are no specific blogs for SOX22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SOX22 Antibody (2D3) and receive a gift card or discount.


Gene Symbol SOX12