Recombinant Human SOX21 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SOX21 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 224-265 of Human SOX21 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SOX21
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SOX21 Protein

  • SOX21
  • SOX25
  • SOX25SOX-A
  • SOXA
  • SRY (sex determining region Y)-box 21
  • SRY-box 21
  • transcription factor SOX-21

Background

SOX21 - SRY (sex determining region Y)-box 21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF2569
Species: Hu
Applications: WB, ICC
AF3369
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF3075
Species: Hu
Applications: WB, ICC
NBP1-85823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-36500
Species: Hu
Applications: IHC, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF2864
Species: Hu
Applications: WB, ICC
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5286
Species: Hu
Applications: WB
NBP1-86503
Species: Hu
Applications: WB, IHC, IHC-P
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61420
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for SOX21 Partial Recombinant Protein (H00011166-Q01) (0)

There are no publications for SOX21 Partial Recombinant Protein (H00011166-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX21 Partial Recombinant Protein (H00011166-Q01) (0)

There are no reviews for SOX21 Partial Recombinant Protein (H00011166-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX21 Partial Recombinant Protein (H00011166-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SOX21 Products

Bioinformatics Tool for SOX21 Partial Recombinant Protein (H00011166-Q01)

Discover related pathways, diseases and genes to SOX21 Partial Recombinant Protein (H00011166-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX21 Partial Recombinant Protein (H00011166-Q01)

Discover more about diseases related to SOX21 Partial Recombinant Protein (H00011166-Q01).
 

Pathways for SOX21 Partial Recombinant Protein (H00011166-Q01)

View related products by pathway.

PTMs for SOX21 Partial Recombinant Protein (H00011166-Q01)

Learn more about PTMs related to SOX21 Partial Recombinant Protein (H00011166-Q01).

Blogs on SOX21

There are no specific blogs for SOX21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SOX21 Antibody
NBP2-59059

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SOX21 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX21
Entrez