Sorting Nexin 31 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LEAFQKEDSQTKFLELAREVRHYGYLQLDPCTCDYPESGSGAVLSVGNNEISCCITLPDSQTQDIVFQMSRVKCWQVTFLGTLLDTDGPQRTLNQNLE |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SNX31 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:50-1:200
- Western Blot 1:100-1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Sorting Nexin 31 Antibody
Background
SNX31, also known as Sorting nexin 31, has 2 isoforms, a 440 amino acid long isoform that is 51 kDa and a short 341 amino acid isoform that is 39 kDa, and may be involved in protein trafficking. The protein is being studied for its involvement in lupus erythematosus. This protein is being linked to cell communication and protein transport biological processes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Rt(-)
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: ICC/IF, KO, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu
Applications: WB, IHC, IHC-P
Publications for Sorting Nexin 31 Antibody (NBP1-92423) (0)
There are no publications for Sorting Nexin 31 Antibody (NBP1-92423).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Sorting Nexin 31 Antibody (NBP1-92423) (0)
There are no reviews for Sorting Nexin 31 Antibody (NBP1-92423).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Sorting Nexin 31 Antibody (NBP1-92423) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Sorting Nexin 31 Products
Bioinformatics Tool for Sorting Nexin 31 Antibody (NBP1-92423)
Discover related pathways, diseases and genes to Sorting Nexin 31 Antibody (NBP1-92423). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Sorting Nexin 31 Antibody (NBP1-92423)
Discover more about diseases related to Sorting Nexin 31 Antibody (NBP1-92423).
| | Pathways for Sorting Nexin 31 Antibody (NBP1-92423)
View related products by pathway.
|
Research Areas for Sorting Nexin 31 Antibody (NBP1-92423)
Find related products by research area.
|
Blogs on Sorting Nexin 31