Sodium Potassium ATPase Beta 1 Recombinant Protein Antigen

Images

 
There are currently no images for Sodium Potassium ATPase Beta 1 Recombinant Protein Antigen (NBP2-54665PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Sodium Potassium ATPase Beta 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP1B1.

Source: E. coli

Amino Acid Sequence: SEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP1B1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54665.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Sodium Potassium ATPase Beta 1 Recombinant Protein Antigen

  • adenosinetriphosphatase
  • ATP1B
  • ATP1B1
  • ATPase, Na+/K+ transporting, beta 1 polypeptide
  • Beta 1-subunit of Na(+)
  • K(+)-ATPase
  • MGC1798
  • Na, K-ATPase beta-1 polypeptide
  • Sodium Potassium ATPase Beta 1
  • sodium/potassium-dependent ATPase beta-1 subunit
  • Sodium/potassium-dependent ATPase subunit beta-1
  • sodium/potassium-transporting ATPase beta-1 chain
  • sodium/potassium-transporting ATPase subunit beta-1

Background

Sodium Potassium ATPase Beta 1 (ATP1B1) is an integral membrane protein complex that hydrolyzes ATP to maintain the transmembrane gradients of Na+ and K+ found in most mammalian cells. Na/K ATPase pumps consist of alpha/beta heterodimers. Beta 1 is the glycosylated, non-catalytic component of the active enzyme responsible for the formation of these alpha/beta heterodimers. Through this assembly, the beta polypeptide regulates the number of sodium pumps transported to the plasma membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
AF4709
Species: Mu
Applications: IP, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB5745
Species: Hu
Applications: IHC, WB
NBP1-86125
Species: Hu
Applications: IHC,  IHC-P
NBP2-01506
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-87069
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-45978
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP2-94614
Species: Mu, Rt
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-146
Species: Bv, Ca, Dr, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh, Xp, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
H00028299-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr,  IHC-P
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC

Publications for Sodium Potassium ATPase Beta 1 Recombinant Protein Antigen (NBP2-54665PEP) (0)

There are no publications for Sodium Potassium ATPase Beta 1 Recombinant Protein Antigen (NBP2-54665PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sodium Potassium ATPase Beta 1 Recombinant Protein Antigen (NBP2-54665PEP) (0)

There are no reviews for Sodium Potassium ATPase Beta 1 Recombinant Protein Antigen (NBP2-54665PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Sodium Potassium ATPase Beta 1 Recombinant Protein Antigen (NBP2-54665PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sodium Potassium ATPase Beta 1 Products

Research Areas for Sodium Potassium ATPase Beta 1 Recombinant Protein Antigen (NBP2-54665PEP)

Find related products by research area.

Blogs on Sodium Potassium ATPase Beta 1

There are no specific blogs for Sodium Potassium ATPase Beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Sodium Potassium ATPase Beta 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP1B1