Sodium Potassium ATPase Alpha 2 Antibody - BSA Free

Images

 
Western Blot: Sodium Potassium ATPase Alpha 2 Antibody [NBP3-10276] - Western blot analysis of Sodium Potassium ATPase Alpha 2 in Human Du145 Whole Cell lysates. Antibody dilution at 1ug/ml

Order Details


    • Catalog Number
      NBP3-10276
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Sodium Potassium ATPase Alpha 2 Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human Sodium Potassium ATPase Alpha 2 (NP_000693.1). Peptide sequence TTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAMEDEPSNDNLYLGV
Clonality
Polyclonal
Host
Rabbit
Gene
ATP1A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
112 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Sodium Potassium ATPase Alpha 2 Antibody - BSA Free

  • alpha-A(+) catalytic polypeptide
  • ATP1A2
  • ATPase, Na+/K+ transporting, alpha 2 (+) polypeptide
  • ATPase, Na+/K+ transporting, alpha 2 polypeptide
  • EC 3.6.3
  • EC 3.6.3.9
  • KIAA0778
  • MGC59864
  • MHP2
  • migraine, hemiplegic 2
  • Na(+)/K(+) ATPase alpha-2 subunit
  • Na+/K+ ATPase, alpha-B polypeptide
  • Sodium Potassium ATPase Alpha 2
  • Sodium pump subunit alpha-2
  • sodium/potassium-transporting ATPase alpha-2 chain
  • sodium/potassium-transporting ATPase subunit alpha-2
  • sodium-potassium ATPase

Background

The ubiquitously expressed sodium/potassium-ATPase exists as a oligomeric plasma membrane complex that couples the hydrolysis of one molecule of ATP to the importation of three Na+ ions and two K+ ions against their respective electrochemical gradients. As a member of the P-type family of ion motifs, sodium/potassium-ATPase plays a critical role in maintaining cellular volume, resting membrane potential and Na+-coupled solute transport. Multiple isoforms of three subunits, alpha, beta and gamma, comprise to form the sodium/potassium-ATPase oligomer. The 113 kDa alpha subunit contains the binding sites for ATP and the cations. With a molecular weight between 40 and 60 kDa, the glycosylated beta subunit ensures correct folding and membrane insertion of the alpha subunits. The small 6 kDa gamma subunit co-localizes with the alpha subunit in nephron segments, where it increases the affinity of sodium/potassium-ATPase for ATP. The beta subunit, but not the gamma subunit, is essential for normal activity of sodium/potassium-ATPase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-30941
Species: Hu, Rt
Applications: IHC, WB
NBP1-51843
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-94614
Species: Mu, Rt
Applications: WB
NB300-146
Species: Bv, Ca, Dr, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh, Xp, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-1869
Species: Hu, Mu, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB300-540
Species: Bv, Ca, Gp, Hu, Mu, Pm, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, Single-Cell Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-82023
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB300-147
Species: Bv, Ca, Ch, Ha, Hu, Mu(-), Po, Rb, Rt, Xp
Applications: ICC/IF, IHC,  IHC-P, WB
H00051380-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF2935
Species: Hu
Applications: WB
AF4277
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP3-17040
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00006326-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-29617
Species: Hu
Applications: IHC, IHC-Fr,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC

Publications for Sodium Potassium ATPase Alpha 2 Antibody (NBP3-10276) (0)

There are no publications for Sodium Potassium ATPase Alpha 2 Antibody (NBP3-10276).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sodium Potassium ATPase Alpha 2 Antibody (NBP3-10276) (0)

There are no reviews for Sodium Potassium ATPase Alpha 2 Antibody (NBP3-10276). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sodium Potassium ATPase Alpha 2 Antibody (NBP3-10276) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sodium Potassium ATPase Alpha 2 Products

Research Areas for Sodium Potassium ATPase Alpha 2 Antibody (NBP3-10276)

Find related products by research area.

Blogs on Sodium Potassium ATPase Alpha 2

There are no specific blogs for Sodium Potassium ATPase Alpha 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sodium Potassium ATPase Alpha 2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP1A2