Sodium-Calcium Exchanger Antibody

Images

 
Western Blot: sodium-calcium exchanger Antibody [NBP1-69515] - This Anti-SLC8A3 antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sodium-Calcium Exchanger Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC8A3(solute carrier family 8 (sodium-calcium exchanger), member 3) The peptide sequence was selected from the N terminal of Sodium-Calcium Exchanger. Peptide sequence SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC8A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC8A3 and was validated on Western blot.
Theoretical MW
103 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Sodium-Calcium Exchanger Antibody

  • Na(+)/Ca(2+)-exchange protein 3
  • Na+/Ca2+ exchanger 3
  • NCX3sodium/calcium exchanger SLC8A3
  • sodium/calcium exchanger 3
  • solute carrier family 8 (sodium/calcium exchanger), member 3
  • solute carrier family 8 (sodium-calcium exchanger), member 3

Background

Sodium-Calcium Exchanger is a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner.This gene encodes a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner. Alternative splicing has been observed for this gene and multiple variants have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56483
Species: Hu
Applications: ICC/IF
NBP2-48980
Species: Hu
Applications: IHC
NBP1-83973
Species: Hu
Applications: IHC, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC
NBP2-31010
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92397
Species: Hu
Applications: ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB300-600
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NB120-3529
Species: Hu, Rt, Po
Applications: WB, ELISA, IHC-Fr, IHC-P
NB300-578
Species: Hu, Mu, Rt, Po, Am, Ca, Ch, Fe, Ha, Pm, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-410
Species: Hu, Mu
Applications: WB, IP
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP1-69515
Species: Hu
Applications: WB

Publications for Sodium-Calcium Exchanger Antibody (NBP1-69515) (0)

There are no publications for Sodium-Calcium Exchanger Antibody (NBP1-69515).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sodium-Calcium Exchanger Antibody (NBP1-69515) (0)

There are no reviews for Sodium-Calcium Exchanger Antibody (NBP1-69515). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sodium-Calcium Exchanger Antibody (NBP1-69515) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sodium-Calcium Exchanger Products

Bioinformatics Tool for Sodium-Calcium Exchanger Antibody (NBP1-69515)

Discover related pathways, diseases and genes to Sodium-Calcium Exchanger Antibody (NBP1-69515). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sodium-Calcium Exchanger Antibody (NBP1-69515)

Discover more about diseases related to Sodium-Calcium Exchanger Antibody (NBP1-69515).
 

Pathways for Sodium-Calcium Exchanger Antibody (NBP1-69515)

View related products by pathway.

PTMs for Sodium-Calcium Exchanger Antibody (NBP1-69515)

Learn more about PTMs related to Sodium-Calcium Exchanger Antibody (NBP1-69515).

Blogs on Sodium-Calcium Exchanger

There are no specific blogs for Sodium-Calcium Exchanger, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sodium-Calcium Exchanger Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC8A3
Uniprot