SLC8A3/NCX3 Antibody - BSA Free

Western Blot: sodium-calcium exchanger Antibody [NBP1-69515] - This Anti-SLC8A3 antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC8A3/NCX3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC8A3(solute carrier family 8 (sodium-calcium exchanger), member 3) The peptide sequence was selected from the N terminal of SLC8A3/NCX3. Peptide sequence SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC8A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 103 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC8A3/NCX3 Antibody - BSA Free

• Na(+)/Ca(2+)-exchange protein 3
• Na+/Ca2+ exchanger 3
• NCX3
• NCX3sodium/calcium exchanger SLC8A3
• SLC8A3
• sodium/calcium exchanger 3
• solute carrier family 8 (sodium/calcium exchanger), member 3
• solute carrier family 8 (sodium-calcium exchanger), member 3

Background

Sodium-Calcium Exchanger is a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner.This gene encodes a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner. Alternative splicing has been observed for this gene and multiple variants have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC8A3
• Uniprot:
  • Q96QG2(Human)