SLC24A2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit SLC24A2 Antibody - BSA Free (NBP3-25140) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein SLC24A2 using the following amino acid sequence: TEEGRFREKASILHKIAKKKCHVDENERQNGAANHVEKIELPNSTSTDVEMTPSSDASEPVQNGNLSHNIEGAEAQTADEEEDQPLSLAWPSETRKQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC24A2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
|
| Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SLC24A2 Antibody - BSA Free
Background
Sodium/calcium-potassium exchanger proteins (NCKX1) have been reported to occur in retinal photoreceptors and in brain (NCKX2). Unlike the abundant and widely expressed sodium/calcium exchanger which catalyzes the exchange of 3 sodium ions for 1 calcium ion to modulate intracellular calcium levels, NCKX isoforms exchange 4 sodium ions for 1 calcium and 1 potassium ion. The sodium/calcium-potassium exchanger uses the transmembrane sodium gradient to catalyze countertransport of calcium in a potassium-dependent mechanism against its electrochemical gradient. It is hypothesized that NCKX2 plays a significant role in calcium homeostasis and the regulation of neuronal function.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Ca, Gp, Hu, I, Ma, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P
Publications for SLC24A2 Antibody (NBP3-25140) (0)
There are no publications for SLC24A2 Antibody (NBP3-25140).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLC24A2 Antibody (NBP3-25140) (0)
There are no reviews for SLC24A2 Antibody (NBP3-25140).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SLC24A2 Antibody (NBP3-25140) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SLC24A2 Products
Research Areas for SLC24A2 Antibody (NBP3-25140)
Find related products by research area.
|
Blogs on SLC24A2