SNX26 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SNX26 Antibody [NBP1-92420] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & actin filaments.

Immunohistochemistry-Paraffin: SNX26 Antibody [NBP1-92420] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNX26 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SNX26 Antibody - BSA Free (NBP1-92420) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PPYLPRQQSDGSLLRSQRPMGTSRRGLRGPAQVSAQLRAGGGGRDAPEAAAQSPCSVPSQVPTPGFFSPAPRECLPPFLGVPKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP33
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SNX26 Protein (NBP1-92420PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SNX26 Antibody - BSA Free

• FLJ39019
• neurite outgrowth multiadaptor RhoGAP protein
• NOMA-GAP
• Rho GTPase activating protein 33
• rho GTPase-activating protein 33
• Rho-type GTPase-activating protein 33
• sorting nexin 26
• Sorting nexin-26
• Tc10/CDC42 GTPase-activating protein
• TCGAPSNX26

Background

SNX26 encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. The specific function of this protein has not been elucidated. Alternative splice variants have been described but their full length nature has not been determined. SNX26 may be involved in several stages of intracellular trafficking. It could play an important role in the regulation of glucose transport by insulin. It may act as a downstream effector of RHOQ/TC10 in the regulation of insulin-stimulated glucose transport.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGAP33