SNX20 Antibody (4E9) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: SNX20 Antibody (4E9) [H00124460-M05] - Analysis of monoclonal antibody to SNX20 on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: SNX20 Antibody (4E9) [H00124460-M05] - Detection limit for recombinant GST tagged SNX20 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA, ICC/IF
• Clone: 4E9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SNX20 Antibody (4E9) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SNX20 Antibody (4E9) - Azide and BSA Free (H00124460-M05) is a monoclonal antibody validated for use in ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SLIC1 (NP_699168.1, 47 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVMGKSRPGEMTYPGSRGETGTAPEPDPRCPRQSDM
• Specificity: SLIC1 - selectin ligand interactor cytoplasmic-1 (4E9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SNX20
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
• Application Notes: This product is useful for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SNX20 Antibody (4E9) - Azide and BSA Free

• MGC35578
• selectin ligand interactor cytoplasmic-1
• Selectin ligand-interactor cytoplasmic 1
• SLIC-1
• SLIC1selectin ligand interactor cytoplasmic 1
• sorting nexin 20
• sorting nexin-20

Background

Serves as a sorting protein that cycles P-selectin glycoprotein ligand 1 (PSLG1) into endosomes with no impact on leukocytes recruitement

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNX20
• Entrez:
  • 124460(Human)
• Uniprot:
  • NP_699168(Human)