Recombinant Human SNX12 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SNX12 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 53-159 of Human SNX12 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SNX12

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SNX12 Protein

  • B-cell CLL/lymphoma 7 protein family member C
  • B-cell CLL/lymphoma 7C

Background

SNX12 - sorting nexin 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3926
Species: Hu, Mu, Rt
Applications: WB
AF6567
Species: Hu, Mu
Applications: WB, IHC
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008724-M10
Species: Hu
Applications: WB, ELISA
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NB100-282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13361
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1362
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-88882
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89485
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00029934-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SNX12 Partial Recombinant Protein (H00029934-Q01) (0)

There are no publications for SNX12 Partial Recombinant Protein (H00029934-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX12 Partial Recombinant Protein (H00029934-Q01) (0)

There are no reviews for SNX12 Partial Recombinant Protein (H00029934-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNX12 Partial Recombinant Protein (H00029934-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SNX12 Products

Bioinformatics Tool for SNX12 Partial Recombinant Protein (H00029934-Q01)

Discover related pathways, diseases and genes to SNX12 Partial Recombinant Protein (H00029934-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX12 Partial Recombinant Protein (H00029934-Q01)

Discover more about diseases related to SNX12 Partial Recombinant Protein (H00029934-Q01).
 

Pathways for SNX12 Partial Recombinant Protein (H00029934-Q01)

View related products by pathway.

PTMs for SNX12 Partial Recombinant Protein (H00029934-Q01)

Learn more about PTMs related to SNX12 Partial Recombinant Protein (H00029934-Q01).
 

Research Areas for SNX12 Partial Recombinant Protein (H00029934-Q01)

Find related products by research area.

Blogs on SNX12

There are no specific blogs for SNX12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SNX12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX12