SNRPE Antibody

Images

 
Western Blot: SNRPE Antibody [NBP2-84272] - WB Suggested Anti-SNRPE Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole CellSNRPE is strongly supported by BioGPS gene expression data to be expressed in Human ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNRPE Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of SNRPE. Peptide sequence: AYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFD The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SNRPE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNRPE Antibody

  • B-raf
  • Sm protein E
  • small nuclear ribonucleoprotein E
  • small nuclear ribonucleoprotein polypeptide E
  • SmE
  • Sm-ESME
  • snRNP-E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4540
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-82956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67358
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-67843
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-22527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
NB100-292
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-49938
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
236-EG
Species: Hu
Applications: BA
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-84272
Species: Hu
Applications: WB

Publications for SNRPE Antibody (NBP2-84272) (0)

There are no publications for SNRPE Antibody (NBP2-84272).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNRPE Antibody (NBP2-84272) (0)

There are no reviews for SNRPE Antibody (NBP2-84272). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNRPE Antibody (NBP2-84272) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNRPE Products

Bioinformatics Tool for SNRPE Antibody (NBP2-84272)

Discover related pathways, diseases and genes to SNRPE Antibody (NBP2-84272). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNRPE Antibody (NBP2-84272)

Discover more about diseases related to SNRPE Antibody (NBP2-84272).
 

Pathways for SNRPE Antibody (NBP2-84272)

View related products by pathway.

PTMs for SNRPE Antibody (NBP2-84272)

Learn more about PTMs related to SNRPE Antibody (NBP2-84272).

Blogs on SNRPE

There are no specific blogs for SNRPE, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNRPE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNRPE