SNRPE Antibody - BSA Free

Western Blot: SNRPE Antibody [NBP2-84272] - WB Suggested Anti-SNRPE Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole CellSNRPE is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SNRPE Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SNRPE Antibody - BSA Free (NBP2-84272) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of SNRPE. Peptide sequence: AYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFD The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNRPE
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SNRPE Antibody - BSA Free

• B-raf
• Sm protein E
• small nuclear ribonucleoprotein E
• small nuclear ribonucleoprotein polypeptide E
• SmE
• Sm-ESME
• snRNP-E

Background

Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNRPE