SNAPC3 Antibody

Images

 
Western Blot: SNAPC3 Antibody [NBP2-85785] - WB Suggested Anti-SNAPC3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: PANC1 cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNAPC3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SNAPC3. Peptide sequence: LRDSIRCVSDLQIGGEFSNTPDQAPEHISKDLYKSAFFYFEGTFYNDKRY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SNAPC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNAPC3 Antibody

  • MGC132011
  • MGC33124
  • Proximal sequence element-binding transcription factor subunit beta
  • PSE-binding factor subunit beta
  • PTF subunit beta
  • PTFbeta
  • small nuclear RNA activating complex, polypeptide 3, 50kD
  • small nuclear RNA activating complex, polypeptide 3, 50kDa
  • Small nuclear RNA-activating complex polypeptide 3
  • SNAP50SNAPc 50 kDa subunit
  • SNAPc subunit 3
  • snRNA-activating protein complex 50 kDa subunit
  • snRNA-activating protein complex subunit 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-88319
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00006621-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP3-10291
Species: Hu
Applications: IHC, WB
NBP3-04686
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-47267
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24677
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-83654
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-17176
Species: Hu
Applications: ICC/IF
NBP2-15617
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-55335
Species: Hu
Applications: ICC/IF, WB
NBP2-47609
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009014-B01P
Species: Hu
Applications: ICC/IF, WB
H00009013-T01
Species: Hu
Applications: WB
NBP1-80306
Species: Av, Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-89917
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-58867
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, WB
NBP2-45910
Species: Hu
Applications: IHC, WB
NBP2-85785
Species: Hu
Applications: WB

Publications for SNAPC3 Antibody (NBP2-85785) (0)

There are no publications for SNAPC3 Antibody (NBP2-85785).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNAPC3 Antibody (NBP2-85785) (0)

There are no reviews for SNAPC3 Antibody (NBP2-85785). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNAPC3 Antibody (NBP2-85785) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNAPC3 Products

Bioinformatics Tool for SNAPC3 Antibody (NBP2-85785)

Discover related pathways, diseases and genes to SNAPC3 Antibody (NBP2-85785). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNAPC3 Antibody (NBP2-85785)

Discover more about diseases related to SNAPC3 Antibody (NBP2-85785).
 

Pathways for SNAPC3 Antibody (NBP2-85785)

View related products by pathway.

Blogs on SNAPC3

There are no specific blogs for SNAPC3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNAPC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNAPC3