SNAP29 Antibody

Images

 
Immunohistochemistry-Paraffin: SNAP29 Antibody [NBP1-84552] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNAP29 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNAP29
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SNAP29 Protein (NBP1-84552PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNAP29 Antibody

  • CEDNIK
  • CEDNIKSoluble 29 kDa NSF attachment protein
  • SNAP29
  • SNAP-29FLJ21051
  • synaptosomal-associated protein 29
  • synaptosomal-associated protein, 29kD
  • synaptosomal-associated protein, 29kDa
  • Vesicle-membrane fusion protein SNAP-29

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-56035
Species: Hu
Applications: WB, ICC/IF
AF5664
Species: Hu
Applications: WB, IHC, ICC
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88483
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24481
Species: Hu, Pm, Xp
Applications: WB, IHC-P
MAB6117
Species: Hu
Applications: WB, IHC
NBP1-87439
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
AF5354
Species: Hu
Applications: WB, IHC
AF5687
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
AF5448
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-45925
Species: Hu, Mu, Ca
Applications: WB, IF

Publications for SNAP29 Antibody (NBP1-84552) (0)

There are no publications for SNAP29 Antibody (NBP1-84552).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNAP29 Antibody (NBP1-84552) (0)

There are no reviews for SNAP29 Antibody (NBP1-84552). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SNAP29 Antibody (NBP1-84552) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNAP29 Products

Bioinformatics Tool for SNAP29 Antibody (NBP1-84552)

Discover related pathways, diseases and genes to SNAP29 Antibody (NBP1-84552). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNAP29 Antibody (NBP1-84552)

Discover more about diseases related to SNAP29 Antibody (NBP1-84552).
 

Pathways for SNAP29 Antibody (NBP1-84552)

View related products by pathway.

PTMs for SNAP29 Antibody (NBP1-84552)

Learn more about PTMs related to SNAP29 Antibody (NBP1-84552).

Blogs on SNAP29

There are no specific blogs for SNAP29, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNAP29 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNAP29
Entrez