SNAP29 Antibody - BSA Free

Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNAP29 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SNAP29 Antibody - BSA Free (NBP1-84552) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNI
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNAP29
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SNAP29 Protein (NBP1-84552PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SNAP29 Antibody - BSA Free

• CEDNIK
• CEDNIKSoluble 29 kDa NSF attachment protein
• SNAP29
• SNAP-29FLJ21051
• synaptosomal-associated protein 29
• synaptosomal-associated protein, 29kD
• synaptosomal-associated protein, 29kDa
• Vesicle-membrane fusion protein SNAP-29

Background

SNAP29 (Synaptosomal-associated protein, 29kDa) is involved in multiple membrane trafficking steps and binds tightly to multiple syntaxins. It may act as a negative modulator for neurotransmitter release by slowing recycling of the SNARE-based fusion machinery and synaptic vesicle turnover.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNAP29