Recombinant Human SMN2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related SMN2 Peptides and Proteins

Order Details


    • Catalog Number
      H00006607-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human SMN2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-282 of Human SMN2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SMN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
56.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SMN2 GST (N-Term) Protein

  • BCD541
  • C-BCD541
  • Component of gems 1
  • FLJ76644
  • gemin 1
  • gemin-1
  • MGC20996
  • MGC5208
  • SMN
  • SMNCSMN1
  • SMNT
  • survival motor neuron protein
  • survival of motor neuron 2, centromeric

Background

This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein. While mutations in the telomeric copy are associated with spinal muscular atrophy, mutations in this gene, the centromeric copy, do not lead to disease. This gene may be a modifier of disease caused by mutation in the telomeric copy. The critical sequence difference between the two genes is a single nucleotide in exon 7, which is thought to be an exon splice enhancer. Note that the nine exons of both the telomeric and centromeric copies are designated historically as exon 1, 2a, 2b, and 3-8. It is thought that gene conversion events may involve the two genes, leading to varying copy numbers of each gene. The full length protein encoded by this gene localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein. Four transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF829
Species: Hu
Applications: WB
NBP2-45831
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-52454
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, WB
NBP2-15939
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-672
Species: Bv, Ca, Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, KD, MiAr, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1436
Species: Mu
Applications: WB
NBP1-82991
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-62651
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-20521
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP3-41367
Species: Hu, Mu, Po, Rt
Applications: IHC,  IHC-P, WB
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
NBP2-15143
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-55266
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-83280
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA

Publications for SMN2 Recombinant Protein (H00006607-P01) (0)

There are no publications for SMN2 Recombinant Protein (H00006607-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMN2 Recombinant Protein (H00006607-P01) (0)

There are no reviews for SMN2 Recombinant Protein (H00006607-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMN2 Recombinant Protein (H00006607-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMN2 Products

Research Areas for SMN2 Recombinant Protein (H00006607-P01)

Find related products by research area.

Blogs on SMN2

There are no specific blogs for SMN2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SMN2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMN2