Recombinant Human SMN2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SMN2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 191-294 of Human SMN2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SMN2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SMN2 Protein

  • BCD541
  • C-BCD541
  • Component of gems 1
  • FLJ76644
  • gemin 1
  • gemin-1
  • MGC20996
  • MGC5208
  • SMN
  • SMNCSMN1
  • SMNT
  • survival motor neuron protein
  • survival of motor neuron 2, centromeric

Background

SMN2 - survival of motor neuron 2, centromeric

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB829
Species: Hu
Applications: WB, IHC
NBP1-77177
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
NBP2-52453
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
AF1436
Species: Mu
Applications: WB
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-24740
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP2-49399
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-55266
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-56841
Species: Hu
Applications: WB, ICC/IF

Publications for SMN2 Partial Recombinant Protein (H00006607-Q01) (0)

There are no publications for SMN2 Partial Recombinant Protein (H00006607-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMN2 Partial Recombinant Protein (H00006607-Q01) (0)

There are no reviews for SMN2 Partial Recombinant Protein (H00006607-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMN2 Partial Recombinant Protein (H00006607-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMN2 Products

Bioinformatics Tool for SMN2 Partial Recombinant Protein (H00006607-Q01)

Discover related pathways, diseases and genes to SMN2 Partial Recombinant Protein (H00006607-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMN2 Partial Recombinant Protein (H00006607-Q01)

Discover more about diseases related to SMN2 Partial Recombinant Protein (H00006607-Q01).
 

Pathways for SMN2 Partial Recombinant Protein (H00006607-Q01)

View related products by pathway.

PTMs for SMN2 Partial Recombinant Protein (H00006607-Q01)

Learn more about PTMs related to SMN2 Partial Recombinant Protein (H00006607-Q01).

Blogs on SMN2

There are no specific blogs for SMN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZEB2 Antibody
NBP1-82991

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SMN2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMN2