SMARCC1 Recombinant Protein Antigen

Images

 
There are currently no images for SMARCC1 Protein (NBP1-88720PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SMARCC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMARCC1.

Source: E. coli

Amino Acid Sequence: LLTERQNFHMEQLKYAELRARQQMEQQQHGQNPQQAHQHSGGPGLAPLGAAGHPGMMPHQQPPPYPLMHHQMPPPHPPQPGQIPGPGSMMPGQHMPGRMIPTVAANIHPSGSGPTPPGMPPMPGNILGPRVPLTAPNGMYP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SMARCC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88720.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SMARCC1 Recombinant Protein Antigen

  • BAF155SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily C member 1
  • BRG1-associated factor 155
  • chromatin remodeling complex BAF155 subunit
  • CRACC1
  • mammalian chromatin remodeling complex BRG1-associated factor 155
  • Rsc8
  • SRG3
  • subfamily c, member 1
  • SWI/SNF complex 155 kDa subunit
  • SWI/SNF complex subunit SMARCC1
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI3

Background

The SWI/SNF-related, matrix-associated, actin-dependent regulators of chromatin (SMARC), also called BRG1-associated factors (BAFs), have been identified as components of the human SWI/SNF-like chromatin-remodeling protein complexes. SMARCC1/BAF155 is part of the BAF complex that associates with SMARCA2/Brm and SMARCA4/Brg. The mouse homolog is Srg3 and has been found to be required for embryogenesis and brain development. SMARCC1 is also identified as SWI/SNF complex 155 kDa subunit, and BRG1-associated factor 155.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5738
Species: Hu
Applications: ICC, KO, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC,  IHC-P, WB
NBP1-90014
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-13283
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90017
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88719
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-90012
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00008815-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
3047-CC
Species: Hu
Applications: BA
DPSG10
Species: Hu
Applications: ELISA
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
H00006604-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-88932
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-37380
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB

Publications for SMARCC1 Protein (NBP1-88720PEP) (0)

There are no publications for SMARCC1 Protein (NBP1-88720PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMARCC1 Protein (NBP1-88720PEP) (0)

There are no reviews for SMARCC1 Protein (NBP1-88720PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SMARCC1 Protein (NBP1-88720PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMARCC1 Products

Array NBP1-88720PEP

Research Areas for SMARCC1 Protein (NBP1-88720PEP)

Find related products by research area.

Blogs on SMARCC1

There are no specific blogs for SMARCC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SMARCC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCC1