SMARCC1 Recombinant Protein Antigen

Images

 
There are currently no images for SMARCC1 Protein (NBP1-88720PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SMARCC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMARCC1.

Source: E.coli

Amino Acid Sequence: LLTERQNFHMEQLKYAELRARQQMEQQQHGQNPQQAHQHSGGPGLAPLGAAGHPGMMPHQQPPPYPLMHHQMPPPHPPQPGQIPGPGSMMPGQHMPGRMIPTVAANIHPSGSGPTPPGMPPMPGNILGPRVPLTAPNGMYP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SMARCC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88720.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SMARCC1 Recombinant Protein Antigen

  • BAF155SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily C member 1
  • BRG1-associated factor 155
  • chromatin remodeling complex BAF155 subunit
  • CRACC1
  • mammalian chromatin remodeling complex BRG1-associated factor 155
  • Rsc8
  • SRG3
  • subfamily c, member 1
  • SWI/SNF complex 155 kDa subunit
  • SWI/SNF complex subunit SMARCC1
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
NBP1-90014
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90017
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90012
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00008815-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
H00006604-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88932
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF

Publications for SMARCC1 Protein (NBP1-88720PEP) (0)

There are no publications for SMARCC1 Protein (NBP1-88720PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMARCC1 Protein (NBP1-88720PEP) (0)

There are no reviews for SMARCC1 Protein (NBP1-88720PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SMARCC1 Protein (NBP1-88720PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SMARCC1 Protein (NBP1-88720PEP)

Discover related pathways, diseases and genes to SMARCC1 Protein (NBP1-88720PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMARCC1 Protein (NBP1-88720PEP)

Discover more about diseases related to SMARCC1 Protein (NBP1-88720PEP).
 

Pathways for SMARCC1 Protein (NBP1-88720PEP)

View related products by pathway.

PTMs for SMARCC1 Protein (NBP1-88720PEP)

Learn more about PTMs related to SMARCC1 Protein (NBP1-88720PEP).

Blogs on SMARCC1

There are no specific blogs for SMARCC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ARID1A Antibody
NBP1-88932
SMARCC1 Antibody
NBP2-20415
HDAC1 Antibody
NB100-56340

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SMARCC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCC1