Recombinant Human SmarcAL1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SmarcAL1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 491-599 of Human SmarcAL1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: FTWEQAFLRWLPSLSPDCINVVVTGKDRLTAGLINIVSFDLLSKLEKQLKTPFKVVIIDESHFLKNSRTARCRAAMPVLKVAKRVILLSGTPAMSRPAELYTQIIAVKP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SMARCAL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SmarcAL1 GST (N-Term) Protein

  • ATP-driven annealing helicase
  • EC 3.6.1
  • EC 3.6.4.-
  • HARPSWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A-like protein 1
  • HepA-related protein
  • HHARP
  • SIOD
  • SMARCA-like protein 1
  • subfamily a-like 1
  • Sucrose nonfermenting protein 2-like 1
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin

Background

SMARCAL1 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-252-PB
Species: Hu
Applications: WB, IHC
NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-93301
Species: Hu, Mu, Rt
Applications: WB
NBP2-45677
Species: Hu, Pm
Applications: WB, IHC
NBP1-83077
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
H00000081-M01
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89766
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00050485-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SmarcAL1 Partial Recombinant Protein (H00050485-Q01) (0)

There are no publications for SmarcAL1 Partial Recombinant Protein (H00050485-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SmarcAL1 Partial Recombinant Protein (H00050485-Q01) (0)

There are no reviews for SmarcAL1 Partial Recombinant Protein (H00050485-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SmarcAL1 Partial Recombinant Protein (H00050485-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional SmarcAL1 Products

Bioinformatics Tool for SmarcAL1 Partial Recombinant Protein (H00050485-Q01)

Discover related pathways, diseases and genes to SmarcAL1 Partial Recombinant Protein (H00050485-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SmarcAL1 Partial Recombinant Protein (H00050485-Q01)

Discover more about diseases related to SmarcAL1 Partial Recombinant Protein (H00050485-Q01).
 

Pathways for SmarcAL1 Partial Recombinant Protein (H00050485-Q01)

View related products by pathway.

PTMs for SmarcAL1 Partial Recombinant Protein (H00050485-Q01)

Learn more about PTMs related to SmarcAL1 Partial Recombinant Protein (H00050485-Q01).

Blogs on SmarcAL1

There are no specific blogs for SmarcAL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SmarcAL1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCAL1