SMARCA6 Recombinant Protein Antigen

Images

 
There are currently no images for SMARCA6 Protein (NBP2-38986PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SMARCA6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HELLS.

Source: E. coli

Amino Acid Sequence: VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HELLS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38986.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SMARCA6 Recombinant Protein Antigen

  • EC 3.6.1
  • EC 3.6.4.-
  • helicase, lymphoid-specific
  • LSHSWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin
  • Nbla10143
  • PASGFLJ10339
  • Proliferation-associated SNF2-like protein
  • SMARCA6lymphoid-specific helicase
  • subfamily A, member 6
  • SWI/SNF2-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 6

Background

HELLS, also known as LSH (lymphoid specific helicase), is a member of the SNF2 superfamily of chromatin helicases. HELLS is ubiquitously expressed and is required for the maintenance of normal DNA methylation patterns important to organism development. HELLS function has also been shown to be important to the regulation of proliferation and the expression of senescence-related genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8400
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF5738
Species: Hu
Applications: ICC, KO, WB
NBP3-13283
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
H00004627-M03
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NB300-516
Species: Hu, Mu, Rt
Applications: ChIP, IHC, IHC-P, KD, Simple Western, WB
H00004891-M01
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00080216-B01P
Species: Hu
Applications: WB
NBP1-88988
Species: Hu
Applications: ICC/IF, KD, WB
NBP1-44643
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF
664-LI/CF
Species: Hu
Applications: BA
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP2-38986PEP
Species: Hu
Applications: AC

Publications for SMARCA6 Protein (NBP2-38986PEP) (0)

There are no publications for SMARCA6 Protein (NBP2-38986PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMARCA6 Protein (NBP2-38986PEP) (0)

There are no reviews for SMARCA6 Protein (NBP2-38986PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SMARCA6 Protein (NBP2-38986PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMARCA6 Products

Bioinformatics Tool for SMARCA6 Protein (NBP2-38986PEP)

Discover related pathways, diseases and genes to SMARCA6 Protein (NBP2-38986PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMARCA6 Protein (NBP2-38986PEP)

Discover more about diseases related to SMARCA6 Protein (NBP2-38986PEP).
 

Pathways for SMARCA6 Protein (NBP2-38986PEP)

View related products by pathway.

PTMs for SMARCA6 Protein (NBP2-38986PEP)

Learn more about PTMs related to SMARCA6 Protein (NBP2-38986PEP).
 

Research Areas for SMARCA6 Protein (NBP2-38986PEP)

Find related products by research area.

Blogs on SMARCA6

There are no specific blogs for SMARCA6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SMARCA6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HELLS