SLX4 Interacting Protein Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C20orf94 Antibody [NBP2-14567] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: C20orf94 Antibody [NBP2-14567] - Staining of human liver shows strong positivity in cytoplasm granular in hepatocytes.
Immunohistochemistry-Paraffin: C20orf94 Antibody [NBP2-14567] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: C20orf94 Antibody [NBP2-14567] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: C20orf94 Antibody [NBP2-14567] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: C20orf94 Antibody [NBP2-14567] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLX4 Interacting Protein Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: MGQAKDSIKAAESHWGLPVQKLEKVNQTQPEDTSGQQKPHPGERLKTGLLSRSPVCSCESASPCPKQSPRVAKTQQKRRNCSSAEDFDHHGRVSLGSDRLVPR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLX4IP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLX4 Interacting Protein Recombinant Protein Antigen (NBP2-14567PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLX4 Interacting Protein Antibody

  • bA204H22.1
  • bA254M13.1
  • C20orf94 chromosome 20 open reading frame 94
  • chromosome 20 open reading frame 94
  • dJ1099D15.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28680
Species: Hu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB110-57130
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-07211
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-24587
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-22527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
NB100-292
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-49938
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-95212
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14567
Species: Hu
Applications: ICC/IF, IHC

Publications for SLX4 Interacting Protein Antibody (NBP2-14567) (0)

There are no publications for SLX4 Interacting Protein Antibody (NBP2-14567).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLX4 Interacting Protein Antibody (NBP2-14567) (0)

There are no reviews for SLX4 Interacting Protein Antibody (NBP2-14567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLX4 Interacting Protein Antibody (NBP2-14567) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLX4 Interacting Protein Products

Blogs on SLX4 Interacting Protein

There are no specific blogs for SLX4 Interacting Protein, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLX4 Interacting Protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLX4IP