SLP-76/LCP2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LCP2. Source: E. coli
Amino Acid Sequence: GARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
LCP2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87033. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SLP-76/LCP2 Recombinant Protein Antigen
Background
SLP76 (SH2 domain containing leukocyte protein of 76 kDa) is a hematopoietic cell-specific adaptor protein that is crucial for T-cell receptor (TCR) signaling, hemostasis and platelet function. TCR ligation and fibrinogen binding to integrin alpha 2 beta 3 stimulates the phosphorylation of the tyrosine residues in the amino terminus, and facilitates SLP76 binding to the SH2 domain of Vav, which can activate JNK. SLP76 also comprises a proline-rich domain region that associates with the SH3 domain of Grb2 linking SLP76 to the Ras to Raf to ERK1 & 2 signaling pathway, LAT, PLC gamma, Fyn-binding protein (SLAP130), the SH2 containing phosphatase 1 and Nck, which mediates the regulation of cytoskeletal actin polymerization. Phosphorylation of tyrosine 145 has been shown to be important for optimal SLP76 function.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC, WB
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Publications for SLP-76/LCP2 Protein (NBP1-87033PEP) (0)
There are no publications for SLP-76/LCP2 Protein (NBP1-87033PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SLP-76/LCP2 Protein (NBP1-87033PEP) (0)
There are no reviews for SLP-76/LCP2 Protein (NBP1-87033PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SLP-76/LCP2 Protein (NBP1-87033PEP) (0)
Additional SLP-76/LCP2 Products
Research Areas for SLP-76/LCP2 Protein (NBP1-87033PEP)
Find related products by research area.
|
Blogs on SLP-76/LCP2