SLP-76/LCP2 Recombinant Protein Antigen

Images

 
There are currently no images for SLP-76/LCP2 Protein (NBP1-87032PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLP-76/LCP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LCP2.

Source: E. coli

Amino Acid Sequence: PNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LCP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87032.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLP-76/LCP2 Recombinant Protein Antigen

  • LCP2
  • lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of76kDa)
  • lymphocyte cytosolic protein 2 (SH2 domain-containing leukocyte protein of76kD)
  • lymphocyte cytosolic protein 2
  • SH2 domain-containing leukocyte protein of 76 kDa
  • SH2 domain-containing leukocyte protein of 76kD
  • SLP-76 tyrosine phosphoprotein
  • SLP76
  • SLP-76
  • SLP7676 kDa tyrosine phosphoprotein

Background

SLP76 (SH2 domain containing leukocyte protein of 76 kDa) is a hematopoietic cell-specific adaptor protein that is crucial for T-cell receptor (TCR) signaling, hemostasis and platelet function. TCR ligation and fibrinogen binding to integrin alpha 2 beta 3 stimulates the phosphorylation of the tyrosine residues in the amino terminus, and facilitates SLP76 binding to the SH2 domain of Vav, which can activate JNK. SLP76 also comprises a proline-rich domain region that associates with the SH3 domain of Grb2 linking SLP76 to the Ras to Raf to ERK1 & 2 signaling pathway, LAT, PLC gamma, Fyn-binding protein (SLAP130), the SH2 containing phosphatase 1 and Nck, which mediates the regulation of cytoskeletal actin polymerization. Phosphorylation of tyrosine 145 has been shown to be important for optimal SLP76 function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27104
Species: Hu, Mu, Pm
Applications: IHC,  IHC-P, WB
NB100-796
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-92440
Species: Hu
Applications: IHC,  IHC-P
AF3709
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
MAB37861
Species: Hu
Applications: ICC, Simple Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
202-IL
Species: Hu
Applications: BA
NBP2-37585
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF3846
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB7500
Species: Hu
Applications: ICC, WB
MAB4841
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
NBP1-86588
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-37490
Species: Hu, Pm, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
7268-CT
Species: Hu
Applications: BA

Publications for SLP-76/LCP2 Protein (NBP1-87032PEP) (0)

There are no publications for SLP-76/LCP2 Protein (NBP1-87032PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLP-76/LCP2 Protein (NBP1-87032PEP) (0)

There are no reviews for SLP-76/LCP2 Protein (NBP1-87032PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLP-76/LCP2 Protein (NBP1-87032PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLP-76/LCP2 Products

Research Areas for SLP-76/LCP2 Protein (NBP1-87032PEP)

Find related products by research area.

Blogs on SLP-76/LCP2

There are no specific blogs for SLP-76/LCP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLP-76/LCP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LCP2