Recombinant Human SLK Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SLK Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1126-1235 of Human SLK partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KHENQMRDLQLQCEANVRELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLEEEFARKLQEQEVFFKMTGESECLNPSTQSRISKFYPIPSLHSTGS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLK
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLK Protein

  • bA16H23.1
  • CTCL tumor antigen se20-9
  • EC 2.7.11
  • EC 2.7.11.1
  • hSLK
  • KIAA0204LOSK
  • Long Ste20-like Kinase
  • se20-9
  • Serine/threonine-protein kinase 2
  • SNF1 (sucrose nonfermenting, yeast, homolog)-like kinase, SNF1 sucrosenonfermenting like kinase (yeast)
  • SNF1 (sucrose nonfermenting, yeast, homolog)-like kinase, SNF1 sucrosenonfermenting like kinase
  • SNF1 sucrose nonfermenting like kinase
  • STE20-like kinaseSTE20-like kinase (yeast)
  • STE20-like serine/threonine-protein kinase
  • STE20-related kinase
  • Ste20-related serine/threonine kinase
  • STE20-related serine/threonine-protein kinase
  • STK2MGC133067

Background

SLK - STE20-like kinase (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-84988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLK Partial Recombinant Protein (H00009748-Q01) (0)

There are no publications for SLK Partial Recombinant Protein (H00009748-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLK Partial Recombinant Protein (H00009748-Q01) (0)

There are no reviews for SLK Partial Recombinant Protein (H00009748-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLK Partial Recombinant Protein (H00009748-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLK Products

Bioinformatics Tool for SLK Partial Recombinant Protein (H00009748-Q01)

Discover related pathways, diseases and genes to SLK Partial Recombinant Protein (H00009748-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLK Partial Recombinant Protein (H00009748-Q01)

Discover more about diseases related to SLK Partial Recombinant Protein (H00009748-Q01).
 

Pathways for SLK Partial Recombinant Protein (H00009748-Q01)

View related products by pathway.

PTMs for SLK Partial Recombinant Protein (H00009748-Q01)

Learn more about PTMs related to SLK Partial Recombinant Protein (H00009748-Q01).

Blogs on SLK

There are no specific blogs for SLK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SLK Antibody
NBP1-83024

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLK