We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SLC7A7 Recombinant Protein Antigen

Images

 
There are currently no images for SLC7A7 Protein (NBP1-82826PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC7A7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC7A7.

Source: E. coli

Amino Acid Sequence: DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC7A7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82826.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC7A7 Recombinant Protein Antigen

  • LAT3
  • LPI
  • Monocyte amino acid permease 2
  • MOP-2
  • SLC7A7
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
  • Solute carrier family 7 member 7
  • Y+L amino acid transporter 1
  • Y+LAT1
  • y+LAT-1y(+)L-type amino acid transporter 1

Background

SLC7A7 is encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-80662
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC,  IHC-P, WB
NBP2-75086
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-50465
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC,  IHC-P
NB110-55498
Species: Ca, Hu
Applications: IHC, IHC-Fr,  IHC-P, WB
H00006541-M02
Species: Hu, Mu
Applications: ELISA, S-ELISA, WB
NBP1-47989
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-00289
Species: Hu
Applications: Flow-CS, Flow, IHC,  IHC-P, IP, WB
NBP3-47196
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-93699
Species: Mu
Applications: ELISA, WB
AF4066
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP1-87377
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
291-G1
Species: Hu
Applications: BA
NBP2-93638
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
MAB5018
Species: Hu
Applications: IP, WB
NLS32
Species: Bt, Bv, Ca, Eq, Hu, Pm, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
2914-HT
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB

Publications for SLC7A7 Protein (NBP1-82826PEP) (0)

There are no publications for SLC7A7 Protein (NBP1-82826PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A7 Protein (NBP1-82826PEP) (0)

There are no reviews for SLC7A7 Protein (NBP1-82826PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC7A7 Protein (NBP1-82826PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC7A7 Products

Blogs on SLC7A7

There are no specific blogs for SLC7A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC7A7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A7