Recombinant Human SLC7A7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SLC7A7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 462-511 of Human SLC7A7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN

Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC7A7

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC7A7 Protein

  • LAT3
  • LPI
  • Monocyte amino acid permease 2
  • MOP-2
  • SLC7A7
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
  • Solute carrier family 7 member 7
  • Y+L amino acid transporter 1
  • Y+LAT1
  • y+LAT-1y(+)L-type amino acid transporter 1

Background

The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36491
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS
NBP2-30868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NLS164
Species: Hu
Applications: IHC, IHC-P
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47989
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
2984-SE
Species: Hu
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-58924
Species: Hu
Applications: ICC/IF
MAB4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-87377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for SLC7A7 Partial Recombinant Protein (H00009056-Q01) (0)

There are no publications for SLC7A7 Partial Recombinant Protein (H00009056-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A7 Partial Recombinant Protein (H00009056-Q01) (0)

There are no reviews for SLC7A7 Partial Recombinant Protein (H00009056-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC7A7 Partial Recombinant Protein (H00009056-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC7A7 Products

Bioinformatics Tool for SLC7A7 Partial Recombinant Protein (H00009056-Q01)

Discover related pathways, diseases and genes to SLC7A7 Partial Recombinant Protein (H00009056-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC7A7 Partial Recombinant Protein (H00009056-Q01)

Discover more about diseases related to SLC7A7 Partial Recombinant Protein (H00009056-Q01).
 

Pathways for SLC7A7 Partial Recombinant Protein (H00009056-Q01)

View related products by pathway.

PTMs for SLC7A7 Partial Recombinant Protein (H00009056-Q01)

Learn more about PTMs related to SLC7A7 Partial Recombinant Protein (H00009056-Q01).

Blogs on SLC7A7

There are no specific blogs for SLC7A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SLC7A7 Antibody
H00009056-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC7A7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A7
Entrez