SLC7A7 Antibody - Azide and BSA Free

Western Blot: SLC7A7 Antibody [H00009056-B01P] - Analysis of SLC7A7 expression in rat brain.

Western Blot: SLC7A7 Antibody [H00009056-B01P] - Analysis of SLC7A7 expression in transfected 293T cell line by SLC7A7 polyclonal antibody. Lane1:SLC7A7 transfected lysate(56.21 KDa). Lane2:Non-transfected lysate.

• Reactivity: Hu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC7A7 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: SLC7A7 (AAH03062.1, 1 a.a. - 511 a.a.) full-length human protein. MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
• Specificity: SLC7A7 - solute carrier family 7 (cationic amino acid transporter, y+ system), member 7,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: SLC7A7
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC7A7 Antibody - Azide and BSA Free

• LAT3
• LPI
• Monocyte amino acid permease 2
• MOP-2
• SLC7A7
• solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
• Solute carrier family 7 member 7
• Y+L amino acid transporter 1
• Y+LAT1
• y+LAT-1y(+)L-type amino acid transporter 1

Background

The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC7A7 Antibody (H00009056-B01P)(2)

Publications using H00009056-B01P

• Ji X, Yang X, Wang N et al. Function of SLC7A7 in T-Cell Acute Lymphoblastic Leukemia. Cell Physiol Biochem 2018-07-19 [PMID: 30025393]
• Barilli A, Rotoli BM, Visigalli R et al. Arginine transport in human monocytic leukemia THP-1 cells during macrophage differentiation. J Leukoc Biol. 2011-05-17 [PMID: 21586674]

Bioinformatics

• Gene Symbol: SLC7A7
• Entrez:
  • 9056(Human)
• Uniprot:
  • AAH03062.1(Human)