Home » SLC7A7 » SLC7A7 Antibodies » SLC7A7 Antibody

SLC7A7 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: SLC7A7 Antibody [H00009056-B01P] - Analysis of SLC7A7 expression in rat brain.
Western Blot: SLC7A7 Antibody [H00009056-B01P] - Analysis of SLC7A7 expression in rat brain.
Western Blot: SLC7A7 Antibody [H00009056-B01P] - Analysis of SLC7A7 expression in transfected 293T cell line by SLC7A7 polyclonal antibody. Lane1:SLC7A7 transfected lysate(56.21 KDa). Lane2:Non-transfected lysate.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SLC7A7 Antibody Summary

Immunogen
SLC7A7 (AAH03062.1, 1 a.a. - 511 a.a.) full-length human protein. MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
Specificity
SLC7A7 - solute carrier family 7 (cationic amino acid transporter, y+ system), member 7,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SLC7A7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00009056-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC7A7 Antibody

  • LAT3
  • LPI
  • Monocyte amino acid permease 2
  • MOP-2
  • SLC7A7
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
  • Solute carrier family 7 member 7
  • Y+L amino acid transporter 1
  • Y+LAT1
  • y+LAT-1y(+)L-type amino acid transporter 1

Background

The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD98 Antibody
NBP2-47515
Western Blot: CD98 Antibody [NBP2-47515] - Analysis in human cell lines SK-MEL-30 and HEK293 using anti-SLC3A2 antibody. Corresponding SLC3A2 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Immunocytochemistry/Immunofluorescence: CD98 Antibody [NBP2-47515] - Staining of human cell line U-2 OS shows localization to nucleus, plasma membrane and cytosol.
Immunohistochemistry-Paraffin: CD98 Antibody [NBP2-47515] - Staining in human parathyroid gland and skeletal muscle tissues using anti-SLC3A2 antibody. Corresponding SLC3A2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SLC7A6 Knockout
HeLa Cell Lysate
NBP2-64989
SLC7A6 Knockout HeLa Cell Lysate
Species: Hu
SLC7A5/LAT1
Antibody (BU53)
NBP2-50465
Flow (Cell Surface): SLC7A5/LAT1 Antibody (BU53) [NBP2-50465] - A cell surface stain was performed on Raji cells with SLC7A5 (BU53) antibody NBP2-50465AF647 (blue) along with a matched isotype control NB600-986AF647 (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at RT. Both antibodies were conjugated to Alexa Fluor 647.
Flow (Cell Surface): SLC7A5/LAT1 Antibody (BU53) [NBP2-50465] - A cell surface stain was performed on Raji cells with SLC7A5 (BU53) antibody NBP2-50465 (blue) along with a matched isotype control NB600-986 (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at RT, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
GPR55 Antibody
NLS164
Immunohistochemistry-Paraffin: GPR55 Antibody [NLS164] - Anti-GPR55 antibody IHC of human prostate, benign prostatic hyperplasia. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry: GPR55 Antibody [NLS164] - Analysis of anti-GPR55 antibody with brain, putamen at 2 ug/ ml.
Immunohistochemistry-Paraffin: GPR55 Antibody [NLS164] - Analysis of anti-GPR55 antibody with human brain, glioblastoma.
Species: Hu, Mk
Applications: IHC, IHC-P
CAT1 Antibody
NBP1-90066
Western Blot: CAT1 Antibody [NBP1-90066] - Analysis in control (vector only transfected HEK293T lysate) and SLC7A1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: CAT1 Antibody [NBP1-90066] - Staining of human small intestine shows strong membranous positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
SLC7A8 Antibody
(OTI7D6)
NBP1-47989
Western Blot: SLC7A8 Antibody (7D6) [NBP1-47989] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SLC7A8 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SLC7A8.
Immunohistochemistry-Paraffin: SLC7A8 Antibody (7D6) [NBP1-47989] - Carcinoma of bladder tissue.
Immunohistochemistry-Paraffin: SLC7A8 Antibody (7D6) [NBP1-47989] - Staining of paraffin-embedded Adenocarcinoma of breast tissue using anti-SLC7A8 mouse monoclonal antibody.
Species: Hu
Applications: WB, IHC, IHC-P
Lipoprotein a
Antibody (4H1)
NBP2-37477
Western Blot: Lipoprotein a Antibody (4H1) [NBP2-37477] - Western blot analysis using LPA mAb against human LPA recombinant protein. (Expected MW is 34.1 kDa)
Immunocytochemistry/Immunofluorescence: Lipoprotein a Antibody (4H1) [NBP2-37477] - Immunofluorescence analysis of HepG2 cells using LPA mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: Lipoprotein a Antibody (4H1) [NBP2-37477] - Immunohistochemical analysis of paraffin-embedded rectum cancer tissues using LPA mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
LAT Antibody
(LAT.10-17)
NBP2-00289
Western Blot: LAT Antibody (LAT.10-17) [NBP2-00289] - 10e6 normal peripheral human blood cells (lane 1), Jurkat (lane 2), and C57BL/6 splenocytes (lane 3) with 5 ug/mL Anti-Human LAT Purified. Bands were visualized using Anti-Mouse IgG HRP.
Immunohistochemistry-Paraffin: LAT Antibody (LAT.10-17) [NBP2-00289] - Staining of human thymus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 20 ug/ml.
Flow (Cell Surface): LAT Antibody (LAT.10-17) [NBP2-00289] - Analysis using the Allophycocyanin conjugate of NBP2-00289. Surface staining of normal human peripheral blood cells with Anti-Human CD3 FITC followed by intracellular staining with Mouse IgG1 kappa Isotype Control APC (left) or Anti-Human LAT APC (right).
Species: Hu
Applications: WB, Flow, IHC-P, IP, Flow-CS
Proprotein
Convertase 7/PCSK7
2984-SE
Proprotein Convertase 7/PCSK7
Species: Hu
MTSS1 Antibody
NBP2-24716
Western Blot: MTSS1 Antibody [NBP2-24716] - Analysis of MTSS1 in human testis lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse and 4) rat testis lysate using NBP2-24716 at 2 ug/ml, 4 ug/ml and 2 ug/ml, respectively.
Immunohistochemistry-Paraffin: MTSS1 Antibody [NBP2-24716] - Analysis of human colon using this antibody at 10 ug/ml.
Species: Hu, Pm
Applications: WB, IHC-P
SLC7A2 Antibody
NBP2-58924
Immunocytochemistry/Immunofluorescence: SLC7A2 Antibody [NBP2-58924] - Staining of human cell line MCF7 shows localization to plasma membrane.
Species: Hu
Applications: ICC/IF
NTAL Antibody
(440005)
MAB4066
Western blot shows lysates of Raji human Burkitt's lymphoma cell line and THP‑1 human acute monocytic leukemia cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human NTAL Monoclonal Antibody (Catalog # MAB4066) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for NTAL at approximately 30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
THP‑1 human acute monocytic leukemia cell line was stained with Mouse Anti-Human NTAL Monoclonal Antibody (Catalog # MAB4066, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Teashirt homolog 1
Antibody
NBP1-87377
Western Blot: Teashirt homolog 1 Antibody [NBP1-87377] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-574
Immunocytochemistry/Immunofluorescence: Teashirt homolog 1 Antibody [NBP1-87377] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Teashirt homolog 1 Antibody [NBP1-87377] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
IGF-I
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(2 Reviews)
(105 Publications)
Species: Hu
SLC7A9 Antibody
NBP1-92409
Immunocytochemistry/Immunofluorescence: SLC7A9 Antibody [NBP1-92409] - Staining of human cell line U-2 OS shows positivity in vesicles.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: SLC7A9 Antibody [NBP1-92409] - Staining of human kidney shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PLA2G1B Antibody
NBP2-32569
Immunocytochemistry/Immunofluorescence: PLA2G1B Antibody [NBP2-32569] - Staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PLA2G1B Antibody [NBP2-32569] - Staining in human pancreas and skeletal muscle tissues using anti-PLA2G1B antibody. Corresponding PLA2G1B RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PLA2G1B Antibody [NBP2-32569] - Staining of human pancreas shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Cannabinoid
R1/CB1/CNR1 Antibody
NLS32
Immunocytochemistry/Immunofluorescence: Cannabinoid R1/CB1/CNR1 Antibody [NLS32] - Analysis of anti-CNR1 / CB1 antibody with HEK293 human embryonic kidney cells.
Immunohistochemistry-Paraffin: Cannabinoid R1/CB1/CNR1 Antibody [NLS32] - Anti-CNR1 / CB1 antibody IHC of human Lymph Node, Non-Hodgkins Lymphoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: Cannabinoid R1/CB1/CNR1 Antibody [NLS32] - Analysis of anti-CNR1 / CB1 antibody with brain, neuron.
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC, IHC-P
CRAT Antibody
NBP1-86616
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Staining in human testis and tonsil tissues using anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Western Blot: CRAT Antibody [NBP1-86616] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu
Applications: WB, IHC, IHC-P
Transferrin
Antibody (HTF-14)
NB500-418
Western Blot: Transferrin Antibody (HTF-14) [NB500-418] - Analysis using the Azide Free version of NB500-418. Detection of 1. hTransferrin; 5 ug/well (red. con.) 2. hTransferrin; 3 ug/well (red. con.) 3. hTransferrin; 1 ug/well (red. con.) M. Low Range marker 4. hTransferrin; 1 ug/well (non-red. con.) 5. hTransferrin; 3 ug/well (non-red. con.) 6. hTransferrin; 5 ug/well (non-red. con.)
(1 Review)
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for SLC7A7 Antibody (H00009056-B01P)(1)


Reviews for SLC7A7 Antibody (H00009056-B01P) (0)

There are no reviews for SLC7A7 Antibody (H00009056-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC7A7 Antibody (H00009056-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC7A7 Antibody (H00009056-B01P)

Discover related pathways, diseases and genes to SLC7A7 Antibody (H00009056-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC7A7 Antibody (H00009056-B01P)

Discover more about diseases related to SLC7A7 Antibody (H00009056-B01P).
 

Pathways for SLC7A7 Antibody (H00009056-B01P)

View related products by pathway.

PTMs for SLC7A7 Antibody (H00009056-B01P)

Learn more about PTMs related to SLC7A7 Antibody (H00009056-B01P).

Blogs on SLC7A7

There are no specific blogs for SLC7A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC7A7 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC7A7
Entrez
Uniprot