Reactivity | Hu, RtSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | SLC7A7 (AAH03062.1, 1 a.a. - 511 a.a.) full-length human protein. MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN |
Specificity | SLC7A7 - solute carrier family 7 (cationic amino acid transporter, y+ system), member 7, |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | SLC7A7 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein A purified |
Publication using H00009056-B01P | Applications | Species |
---|---|---|
Barilli A, Rotoli BM, Visigalli R et al. Arginine transport in human monocytic leukemia THP-1 cells during macrophage differentiation. J Leukoc Biol. 2011 May 17 [PMID: 21586674] |
Secondary Antibodies |
Isotype Controls |
Diseases for SLC7A7 Antibody (H00009056-B01P)Discover more about diseases related to SLC7A7 Antibody (H00009056-B01P).
| Pathways for SLC7A7 Antibody (H00009056-B01P)View related products by pathway.
|
PTMs for SLC7A7 Antibody (H00009056-B01P)Learn more about PTMs related to SLC7A7 Antibody (H00009056-B01P).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | SLC7A7 |
Entrez | |
Uniprot |
|