SLC7A5/LAT1 Recombinant Protein Antigen

Images

 
There are currently no images for SLC7A5/LAT1 Protein (NBP2-33662PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC7A5/LAT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC7A5.

Source: E. coli

Amino Acid Sequence: AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC7A5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33662.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC7A5/LAT1 Recombinant Protein Antigen

  • 4F2 LC
  • 4F2LC
  • CD98
  • CD98lc
  • D16S469EL-type amino acid transporter 1
  • E16
  • Integral membrane protein E16
  • large neutral amino acids transporter 1
  • large neutral amino acids transporter small subunit 1
  • LAT1
  • LAT1hLAT1
  • MPE16
  • MPE16CD98 light chain
  • SLC7A5
  • sodium-independent neutral amino acid transporter LAT1,4F2LC
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 5,4F2 light chain
  • Solute carrier family 7 member 5
  • TA1
  • y+ system cationic amino acid transporter

Background

Mammalian cells have several amino acid transport systems. These systems have been defined by both activity and specific genes. L-type amino acid transporter 1 (LAT1) is a 12 membrane-spanning protein. LAT1 is a Na + -independent neutral amino acid transporter agency and essential for the transporter of large neutral amino acid such as Leucine, Isoleucine, and Valine through the plasma membrane. LAT1 has been proposed to be one of the major nutrient transport systems at the blood-brain barrier. Drugs such as L Dopa are transported by LAT1. LAT1 is thought to be up-regulated to support the high protein synthesis for cell growth in some tumor cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13957
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-80662
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-47989
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF4066
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP1-62583
Species: Hu
Applications: WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
DBD00
Species: Hu
Applications: ELISA
NB100-74635
Species: Hu
Applications: IHC,  IHC-P, IP, WB (-)
NBP2-30949
Species: Hu
Applications: IHC,  IHC-P

Publications for SLC7A5/LAT1 Protein (NBP2-33662PEP) (0)

There are no publications for SLC7A5/LAT1 Protein (NBP2-33662PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A5/LAT1 Protein (NBP2-33662PEP) (0)

There are no reviews for SLC7A5/LAT1 Protein (NBP2-33662PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC7A5/LAT1 Protein (NBP2-33662PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC7A5/LAT1 Products

Research Areas for SLC7A5/LAT1 Protein (NBP2-33662PEP)

Find related products by research area.

Blogs on SLC7A5/LAT1

There are no specific blogs for SLC7A5/LAT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC7A5/LAT1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A5