SLC4A10 Recombinant Protein Antigen

Images

 
There are currently no images for SLC4A10 Protein (NBP1-82594PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC4A10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC4A10.

Source: E.coli

Amino Acid Sequence: FELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLT

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC4A10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82594.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SLC4A10 Recombinant Protein Antigen

  • sodium bicarbonate cotransporter-like, member 10
  • sodium bicarbonate transporter-like, member 10
  • sodium-driven chloride bicarbonate exchanger
  • Solute carrier family 4 member 10
  • solute carrier family 4, sodium bicarbonate transporter, member 10

Background

SLC4A10 is an Na(+)-dependent Cl-/HCO3- exchanger (Jacobs et al., 2008 (PubMed 18165320)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87850
Species: Hu
Applications: IHC, IHC-P
H00009498-M04
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP2-93493
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-38683
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-13340
Species: Hu
Applications: IHC, IHC-P
NB600-749
Species: Hu, Mu, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-15699
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-46156
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP3-13161
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-07598
Species: Hu
Applications: Flow, ICC/IF, PA
NB100-1965
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-85085
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB110-81529
Species: Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IP, KD, KO, Simple Western, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP1-82594PEP
Species: Hu
Applications: AC

Publications for SLC4A10 Protein (NBP1-82594PEP) (0)

There are no publications for SLC4A10 Protein (NBP1-82594PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC4A10 Protein (NBP1-82594PEP) (0)

There are no reviews for SLC4A10 Protein (NBP1-82594PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC4A10 Protein (NBP1-82594PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC4A10 Products

Array NBP1-82594PEP

Bioinformatics Tool for SLC4A10 Protein (NBP1-82594PEP)

Discover related pathways, diseases and genes to SLC4A10 Protein (NBP1-82594PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC4A10 Protein (NBP1-82594PEP)

Discover more about diseases related to SLC4A10 Protein (NBP1-82594PEP).
 

Pathways for SLC4A10 Protein (NBP1-82594PEP)

View related products by pathway.

PTMs for SLC4A10 Protein (NBP1-82594PEP)

Learn more about PTMs related to SLC4A10 Protein (NBP1-82594PEP).
 

Research Areas for SLC4A10 Protein (NBP1-82594PEP)

Find related products by research area.

Blogs on SLC4A10

There are no specific blogs for SLC4A10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC4A10 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC4A10