SLC47A2 Antibody


Western Blot: SLC47A2 Antibody [NBP1-70705] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related SLC47A2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SLC47A2 Antibody Summary

Synthetic peptides corresponding to SLC47A2(solute carrier family 47, member 2) The peptide sequence was selected from the C terminal of SLC47A2. Peptide sequence TYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC47A2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC47A2 Antibody

  • solute carrier family 47, member 2


SLC47A2 is a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance.This gene encodes a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance. This gene is one of two members of the MATE transporter family located near each other on chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC47A2 Antibody (NBP1-70705) (0)

There are no publications for SLC47A2 Antibody (NBP1-70705).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC47A2 Antibody (NBP1-70705) (0)

There are no reviews for SLC47A2 Antibody (NBP1-70705). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC47A2 Antibody (NBP1-70705) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC47A2 Products

SLC47A2 NBP1-70705

Bioinformatics Tool for SLC47A2 Antibody (NBP1-70705)

Discover related pathways, diseases and genes to SLC47A2 Antibody (NBP1-70705). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC47A2 Antibody (NBP1-70705)

Discover more about diseases related to SLC47A2 Antibody (NBP1-70705).

Pathways for SLC47A2 Antibody (NBP1-70705)

View related products by pathway.

Blogs on SLC47A2

There are no specific blogs for SLC47A2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC47A2 Antibody and receive a gift card or discount.


Gene Symbol SLC47A2