SLC45A2 Antibody (1B2)

Images

 
Sandwich ELISA: SLC45A2 Antibody (1B2) [H00051151-M02] - Detection limit for recombinant GST tagged SLC45A2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1B2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLC45A2 Antibody (1B2) Summary

Immunogen
SLC45A2 (AAH03597, 1 a.a. ~ 243 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTDSQGNDIKVTAESTGEHASSLPLPLHQPPHWMDGLPVQHAVLHRFHGPDCVPRGSL
Specificity
SLC45A2 - solute carrier family 45, member 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC45A2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC45A2 Antibody (1B2)

  • AIM-1
  • AIM11A1
  • MATPmembrane associated transporter
  • Melanoma antigen AIM1
  • membrane-associated transporter protein
  • Protein AIM-1
  • SHEP5
  • Solute carrier family 45 member 2
  • solute carrier family 45, member 2
  • underwhite

Background

The protein encoded by this gene encodes a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2289
Species: Gp, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP3-03338
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-24722
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00004948-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-85367
Species: Hu, Mu, Rt, V-Vi
Applications: IHC, IHC-P, WB
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-67020
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-01397
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-03227
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for SLC45A2 Antibody (H00051151-M02) (0)

There are no publications for SLC45A2 Antibody (H00051151-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC45A2 Antibody (H00051151-M02) (0)

There are no reviews for SLC45A2 Antibody (H00051151-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC45A2 Antibody (H00051151-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC45A2 Products

Array H00051151-M02

Bioinformatics Tool for SLC45A2 Antibody (H00051151-M02)

Discover related pathways, diseases and genes to SLC45A2 Antibody (H00051151-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC45A2 Antibody (H00051151-M02)

Discover more about diseases related to SLC45A2 Antibody (H00051151-M02).
 

Pathways for SLC45A2 Antibody (H00051151-M02)

View related products by pathway.

PTMs for SLC45A2 Antibody (H00051151-M02)

Learn more about PTMs related to SLC45A2 Antibody (H00051151-M02).
 

Research Areas for SLC45A2 Antibody (H00051151-M02)

Find related products by research area.

Blogs on SLC45A2

There are no specific blogs for SLC45A2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC45A2 Antibody (1B2) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC45A2
Entrez
OMIM
Uniprot