SLC44A2 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC44A2 Antibody [NBP1-84337] - Staining of human small intestine shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC44A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NENKPYLFYFNIVKCASPLVLLEFQCPTPQICVEKCPDRYLTYLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC44A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC44A2 Protein (NBP1-84337PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC44A2 Antibody

  • CTL2choline transporter-like protein 2
  • DKFZp666A071
  • FLJ44586
  • PP1292
  • Solute carrier family 44 member 2
  • solute carrier family 44, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00023446-A01
Species: Hu, Mu
Applications: WB, ELISA
AF5249
Species: Hu
Applications: WB
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59448
Species: Hu
Applications: WB
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-85116
Species: Hu
Applications: IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-84337
Species: Hu
Applications: IHC, IHC-P

Publications for SLC44A2 Antibody (NBP1-84337) (0)

There are no publications for SLC44A2 Antibody (NBP1-84337).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC44A2 Antibody (NBP1-84337) (0)

There are no reviews for SLC44A2 Antibody (NBP1-84337). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC44A2 Antibody (NBP1-84337) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC44A2 Products

Bioinformatics Tool for SLC44A2 Antibody (NBP1-84337)

Discover related pathways, diseases and genes to SLC44A2 Antibody (NBP1-84337). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC44A2 Antibody (NBP1-84337)

Discover more about diseases related to SLC44A2 Antibody (NBP1-84337).
 

Pathways for SLC44A2 Antibody (NBP1-84337)

View related products by pathway.

PTMs for SLC44A2 Antibody (NBP1-84337)

Learn more about PTMs related to SLC44A2 Antibody (NBP1-84337).
 

Research Areas for SLC44A2 Antibody (NBP1-84337)

Find related products by research area.

Blogs on SLC44A2

There are no specific blogs for SLC44A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC44A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC44A2