SLC39A10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC39A10 Antibody [NBP2-38306] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: SLC39A10 Antibody [NBP2-38306] - Staining of human thyroid gland shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC39A10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGL
Specificity
Specificity of human SLC39A10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC39A10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC39A10 Antibody

  • DKFZp564L2123
  • DKFZp781L10106
  • FLJ90515
  • KIAA1265
  • LZT-Hs2
  • MGC126565
  • MGC138428
  • solute carrier family 39 (metal ion transporter), member 10
  • solute carrier family 39 (zinc transporter), member 10
  • Solute carrier family 39 member 10
  • zinc transporter ZIP10
  • ZIP10
  • ZIP-10
  • Zrt- and Irt-like protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-64636
Species: Hu
NBP1-86380
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC-Fr, IHC-P
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC, IF
NBP1-56561
Species: Hu, Mu, Rt, Bv, Ca, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-59601
Species: Hu, Rt, Po, Ca, Eq
Applications: WB, IHC, IHC-P
NBP1-76498
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76510
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB2380
Species: Hu
Applications: WB
NBP1-59357
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Sh
Applications: WB, IHC, IHC-P
NBP1-69296
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF7315
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-67850
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-05081
Species: Hu
NBP1-85007
Species: Hu
Applications: IHC, IHC-P
H00004502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-66083
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NBP2-68817
Species: Hu
Applications: IHC, IHC-P
NBP2-38306
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SLC39A10 Antibody (NBP2-38306) (0)

There are no publications for SLC39A10 Antibody (NBP2-38306).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC39A10 Antibody (NBP2-38306) (0)

There are no reviews for SLC39A10 Antibody (NBP2-38306). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC39A10 Antibody (NBP2-38306) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC39A10 Products

Bioinformatics Tool for SLC39A10 Antibody (NBP2-38306)

Discover related pathways, diseases and genes to SLC39A10 Antibody (NBP2-38306). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC39A10 Antibody (NBP2-38306)

Discover more about diseases related to SLC39A10 Antibody (NBP2-38306).
 

Pathways for SLC39A10 Antibody (NBP2-38306)

View related products by pathway.

PTMs for SLC39A10 Antibody (NBP2-38306)

Learn more about PTMs related to SLC39A10 Antibody (NBP2-38306).

Blogs on SLC39A10

There are no specific blogs for SLC39A10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC39A10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC39A10
Uniprot