SLC39A10 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SLC39A10 Antibody [NBP2-38306] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.

Immunohistochemistry-Paraffin: SLC39A10 Antibody [NBP2-38306] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: SLC39A10 Antibody [NBP2-38306] - Staining of human endometrium shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: SLC39A10 Antibody [NBP2-38306] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: SLC39A10 Antibody [NBP2-38306] - Staining of human liver shows strong membranous positivity in cholangiocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC39A10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGL
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC39A10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SLC39A10 Protein (NBP2-38306PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC39A10 Antibody - BSA Free

• DKFZp564L2123
• DKFZp781L10106
• FLJ90515
• KIAA1265
• LZT-Hs2
• MGC126565
• MGC138428
• solute carrier family 39 (metal ion transporter), member 10
• solute carrier family 39 (zinc transporter), member 10
• Solute carrier family 39 member 10
• zinc transporter ZIP10
• ZIP10
• ZIP-10
• Zrt- and Irt-like protein 10

Background

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A10 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC39A10
• Uniprot:
  • Q9ULF5(Human)