FLJ10815 Antibody


Western Blot: FLJ10815 Antibody [NBP1-87910] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: FLJ10815 Antibody [NBP1-87910] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: FLJ10815 Antibody [NBP1-87910] - Staining of human liver shows moderate cytoplasmic and nuclear membranous positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

FLJ10815 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTST
Specificity of human FLJ10815 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FLJ10815 Protein (NBP1-87910PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FLJ10815 Antibody

  • amino acid transporter
  • SNAT7
  • solute carrier family 38, member 7


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Pm, Bv(-), Ch(-), Rt(-), Ze(-)
Applications: WB, ICC/IF
Species: Hu
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FLJ10815 Antibody (NBP1-87910) (0)

There are no publications for FLJ10815 Antibody (NBP1-87910).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ10815 Antibody (NBP1-87910) (0)

There are no reviews for FLJ10815 Antibody (NBP1-87910). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FLJ10815 Antibody (NBP1-87910) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FLJ10815 Products

Bioinformatics Tool for FLJ10815 Antibody (NBP1-87910)

Discover related pathways, diseases and genes to FLJ10815 Antibody (NBP1-87910). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for FLJ10815 Antibody (NBP1-87910)

View related products by pathway.

Blogs on FLJ10815

There are no specific blogs for FLJ10815, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FLJ10815 Antibody and receive a gift card or discount.


Gene Symbol SLC38A7