![Western Blot: FLJ10815 Antibody [NBP1-87910] - Analysis in human cell line SiHa.](http://images.novusbio.com/fullsize2/FLJ10815-Antibody-Western-Blot-NBP1-87910-img0003.jpg "Western Blot: FLJ10815 Antibody [NBP1-87910] - Analysis in human cell line SiHa.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTST |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC38A7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Serotonin N-acetyltransferase [p Thr29] Antibody - BSA Free](https://images.novusbio.com/images2/Serotonin-N-acetyltransferase-[p-Thr29]-Antibody-Western-Blot-NB120-3439-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
Pathways for FLJ10815 Antibody (NBP1-87910)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC38A7 |
![Immunohistochemistry-Paraffin: FLJ10815 Antibody [NBP1-87910] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/FLJ10815-Antibody-Immunohistochemistry-Paraffin-NBP1-87910-img0007.jpg "Immunohistochemistry-Paraffin: FLJ10815 Antibody [NBP1-87910] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FLJ10815 Antibody [NBP1-87910] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize2/FLJ10815-Antibody-Immunohistochemistry-Paraffin-NBP1-87910-img0004.jpg "Immunohistochemistry-Paraffin: FLJ10815 Antibody [NBP1-87910] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: FLJ10815 Antibody [NBP1-87910] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize2/FLJ10815-Antibody-Immunohistochemistry-Paraffin-NBP1-87910-img0005.jpg "Immunohistochemistry-Paraffin: FLJ10815 Antibody [NBP1-87910] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: FLJ10815 Antibody [NBP1-87910] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/FLJ10815-Antibody-Immunohistochemistry-Paraffin-NBP1-87910-img0006.jpg "Immunohistochemistry-Paraffin: FLJ10815 Antibody [NBP1-87910] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.")
-Western-Blot-NBP2-59311-img0004.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-59311-img0005.jpg)
-Western-Blot-NBP2-59311-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")