Recombinant Human SLC35F1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SLC35F1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 408 of Human SLC35F1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MIPPEQPQQQLQPPSPAPPNHVVTTIENLPAEGSGGGGSLSASSRAGVRQRIRKVLNREMLISVALGQVLSLLICGIGLTSKYLSEDFHANTPVFQSFLNYILLFLVYTTTLAVRQGEENLLAILRRRWWKYMILGLIDLEANYLVVKAYQYTNLTSIQLLDCFVIPVVILLSWFFLLIRYKAVHFIGIVVCILGMGCMVGADVLVGRHQGAGENKLVGDLLVLGGATLYGISNVWEEYIIRTLSRVEFLGMIGLFGAFFSGIQLAIMEHKELLKVPWDWQIGLLYVGFSACMFGLYSFMQVVIKKTSATSVNLSLLTADLYSLFCGLFLFHYKFSGLYLLSFFTILIGLVLYSSTSTYIAQDPRVYKQFRNPSGPVVDLPTTAQVEPSVTYTSLGQETEEEPHVRVA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SLC35F1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC35F1 Protein

  • C6orf169
  • chromosome 6 open reading frame 169
  • dJ230I3.1
  • FLJ13018
  • solute carrier family 35 member F1
  • solute carrier family 35, member F1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37962
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38364
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-757
Species: Hu
Applications: WB, IHC-P
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83810
Species: Hu
Applications: IHC, IHC-P
NBP2-13332
Species: Hu
Applications: IHC, IHC-P
NBP2-13333
Species: Hu
Applications: IHC, IHC-P
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-81867
Species: Hu
Applications: IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-36746
Species: Hu
Applications: WB, IHC, IHC-P
AF5286
Species: Hu
Applications: WB
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-52737
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80643
Species: Hu
Applications: WB, IHC, IHC-P
H00023169-R01
Species: Hu
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
H00222553-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SLC35F1 Recombinant Protein (H00222553-P01) (0)

There are no publications for SLC35F1 Recombinant Protein (H00222553-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC35F1 Recombinant Protein (H00222553-P01) (0)

There are no reviews for SLC35F1 Recombinant Protein (H00222553-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC35F1 Recombinant Protein (H00222553-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC35F1 Products

SLC35F1 H00222553-P01

Bioinformatics Tool for SLC35F1 Recombinant Protein (H00222553-P01)

Discover related pathways, diseases and genes to SLC35F1 Recombinant Protein (H00222553-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC35F1 Recombinant Protein (H00222553-P01)

Discover more about diseases related to SLC35F1 Recombinant Protein (H00222553-P01).
 

Pathways for SLC35F1 Recombinant Protein (H00222553-P01)

View related products by pathway.

Blogs on SLC35F1

There are no specific blogs for SLC35F1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SLC35F1 Antibody
NBP1-86755

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC35F1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC35F1