SLC35F3 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC35F3 Antibody [NBP2-13332] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC35F3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HVCKSTEKQSVKQRYRECCRFFGDNGLTLK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC35F3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10 - 1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC35F3 Protein (NBP2-13332PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC35F3 Antibody

  • FLJ37712
  • solute carrier family 35 member F3
  • solute carrier family 35, member F3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86755
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-94126
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58197
Species: Hu
Applications: WB, ICC/IF
NBP2-13333
Species: Hu
Applications: IHC, IHC-P
H00023169-R01
Species: Hu
NBP1-81867
Species: Hu
Applications: IHC, IHC-P
NBP2-13332
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for SLC35F3 Antibody (NBP2-13332) (0)

There are no publications for SLC35F3 Antibody (NBP2-13332).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC35F3 Antibody (NBP2-13332) (0)

There are no reviews for SLC35F3 Antibody (NBP2-13332). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC35F3 Antibody (NBP2-13332) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC35F3 Products

Bioinformatics Tool for SLC35F3 Antibody (NBP2-13332)

Discover related pathways, diseases and genes to SLC35F3 Antibody (NBP2-13332). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC35F3 Antibody (NBP2-13332)

Discover more about diseases related to SLC35F3 Antibody (NBP2-13332).
 

Pathways for SLC35F3 Antibody (NBP2-13332)

View related products by pathway.

Blogs on SLC35F3

There are no specific blogs for SLC35F3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC35F3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC35F3