SLC35C2 Antibody - BSA Free

Western Blot: SLC35C2 Antibody [NBP2-83548] - Host: Rabbit. Target Name: SLC35C2. Sample Tissue: Mouse Liver. Antibody Dilution: 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC35C2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC35C2 Antibody - BSA Free (NBP2-83548) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse SLC35C2. Peptide sequence: QDTGLLLWVLGSLLLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC35C2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC35C2 Antibody - BSA Free

• bA394O2.1
• C20orf5
• CGI-15
• FLJ37039
• FLJ46434
• MGC20633
• MGC32079
• MGC39183
• ovarian cancer overexpressed 1
• Ovarian cancer-overexpressed gene 1 protein
• OVCOV1
• solute carrier family 35 member C2
• solute carrier family 35, member C2

Background

Oxygenation levels play an important role in the regulation of cellular invasiveness which occurs during early implantation when the trophoblast cells invade the uterus as well as during tumour progression and metastasis. This gene, which is regulated by oxygen tension, is induced in hypoxic trophoblast cells and is overexpressed in ovarian cancer. Two protein isoforms are encoded by transcript variants of this gene. Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Variants 1 and 2 encode the same isoform (a).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC35C2